NovoPro
Cart 2

HPdO vector

This page is informational only.

Basic Vector Information

Basic Vector Information
Vector Name HPdO Length 8356 bp
Type Cloning vector Source Lin A, Jimenez J, Derr J, Vera P, Manapat ML, Esvelt KM, Villanueva L, Liu DR, Chen IA.

HPdO vector Vector Map

HPdO vector Sequence

Copy Sequence

Download SnapGene Map(.dna)

Download GeneBank File(.gb)

LOCUS       Exported                8356 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector HPdO, complete sequence.
ACCESSION   HQ440210
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8356)
  AUTHORS   Lin A, Jimenez J, Derr J, Vera P, Manapat ML, Esvelt KM, Villanueva 
            L, Liu DR, Chen IA.
  TITLE     Inhibition of Bacterial Conjugation by Phage M13 and Its Protein 
            g3p: Quantitative Analysis and Model
  JOURNAL   PLoS ONE 6 (5), E19991 (2011)
  PUBMED    21637841
REFERENCE   2  (bases 1 to 8356)
  AUTHORS   Esvelt KM, Carlson JC.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-OCT-2010) Chemistry & Chemical Biology, Harvard 
            University, 12 Oxford St, Cambridge, MA 02138, USA
REFERENCE   3  (bases 1 to 8356)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Dec 18, 2018 from SnapGene 4.1.8
            http://www.snapgene.com
FEATURES             Location/Qualifiers
     source          1..8356
                     /organism="Cloning vector HPdO"
                     /host="Escherichia coli"
                     /mol_type="other DNA"
                     /db_xref="taxon:1028764"
     CDS             1..1233
                     /codon_start=1
                     /product="protein II"
                     /label=protein II
                     /protein_id="AEE98856.1"
                     /translation="MIDMLVLRLPFIDSLVCSRLSGNDLIAFVDLSKIATLSGMNLSAR
                     TVEYHVDGDLTVSGLSHPFESLPTHYSGIAFKIYEGSKNFYPCVEIKASPAKVLQGHNV
                     FGTTDLALCSEALLLNFANSLPCLYDLLDVNATTISRIDATFSARAPNENIAKQVIDHL
                     RNVSNGQTKSTRSQNWESTVTWNETSRHRTLVAYLKHVELQHQIQQLSSKPSAKMTSYQ
                     KEQLKVLSNPDLLEFASGLVRFEARIKTRYLKSFGLPLNLFDAIRFASDYNSQGKDLIF
                     DLWSFSFSELFKAFEGDSMNIYDDSAVLDAIQSKHFTITPSGKTSFAKASRYFGFYRRL
                     VNEGYDSVALTMPRNSFWRYVSALVECGIPKSQLMNLSTCNNVVPLVRFINVDFSSQRP
                     DWYNEPVLKIA"
     CDS             898..1233
                     /codon_start=1
                     /product="protein X"
                     /label=protein X
                     /protein_id="AEE98857.1"
                     /translation="MNIYDDSAVLDAIQSKHFTITPSGKTSFAKASRYFGFYRRLVNEG
                     YDSVALTMPRNSFWRYVSALVECGIPKSQLMNLSTCNNVVPLVRFINVDFSSQRPDWYN
                     EPVLKIA"
     CDS             1245..1508
                     /codon_start=1
                     /product="protein V"
                     /label=protein V
                     /protein_id="AEE98858.1"
                     /translation="MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLV
                     KITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK"
     CDS             1510..1611
                     /codon_start=1
                     /product="protein VII"
                     /label=protein VII
                     /protein_id="AEE98859.1"
                     /translation="MEQVADFDTIYQAMIQISVVLCFALGIIAGGQR"
     CDS             1608..1706
                     /codon_start=1
                     /product="protein IX"
                     /label=protein IX
                     /protein_id="AEE98860.1"
                     /translation="MSVLVYSFASFVLGWCLRSGITYFTRLMETSS"
     CDS             1703..1924
                     /codon_start=1
                     /product="protein VIII"
                     /label=protein VIII
                     /protein_id="AEE98861.1"
                     /translation="MKKSLVLKASVAVATLVPMLSFAAEGDDPAKAAFNSLQASATEYI
                     GYAWAMVVVIVGATIGIKLFKKFTSKAS"
     terminator      1928..1976
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     CDS             1981..3255
                     /codon_start=1
                     /product="protein III"
                     /label=protein III
                     /protein_id="AEE98862.1"
                     /translation="MKKLLFAIPLVVPFYSHSAETVESCLAKPHTENSFTNVWKDDKTL
                     DRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGG
                     TKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQ
                     GALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQ
                     GQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSGSGDFDYEKM
                     ANANKGAMTENADENALQSDAKGKLDSVATDYGAAIDGFIGDVSGLANGNGATGDFAGS
                     NSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPFVFGAGKPYEFSIDCDKINLFRGVF
                     AFLLYVATFMYVFSTFANILRNKES"
     CDS             3258..3596
                     /codon_start=1
                     /product="protein VI"
                     /label=protein VI
                     /protein_id="AEE98863.1"
                     /translation="MPVLLGIPLLLRFLGFLLVTLFGYLLTFLKKGFGKIAIAISLFLA
                     LIIGLNSILVGYLSDISAQLPSDFVQGVQLILPSNALPCFYVILSVKAAIFIFDVKQKI
                     VSYLDWDK"
     CDS             3598..4644
                     /codon_start=1
                     /product="protein I"
                     /label=protein I
                     /protein_id="AEE98864.1"
                     /translation="MAVYFVTGKLGSGKTLVSVGKIQDKIVAGCKIATNLDLRLQNLPQ
                     VGRFAKTPRVLRIPDKPSISDLLAIGRGNDSYDENKNGLLVLDECGTWFNTRSWNDKER
                     QPIIDWFLHARKLGWDIIFLVQDLSIVDKQARSALAEHVVYCRRLDRITLPFVGTLYSL
                     ITGSKMPLPKLHVGVVKYGDSQLSPTVERWLYTGKNLYNAYDTKQAFSSNYDSGVYSYL
                     TPYLSHGRYFKPLNLGQKMKLTKIYLKKFSRVLCLAIGFASAFTYSYITQPKPEVKKVV
                     SQTYDFDKFTIDSSQRLNLSYRYVFKDSKGKLINSDDLQKQGYSLTYIDLCTVSIKKGN
                     SNEIVKCN"
     CDS             4622..5902
                     /codon_start=1
                     /product="protein IV"
                     /label=protein IV
                     /protein_id="AEE98865.1"
                     /translation="MKLLNVINFVFLMFVSSSSFAQVIEMNNSPLRDFVTWYSKQSGES
                     VIVSPDVKGTVTVYSSDVKPENLRNFFISVLRANNFDMVGSNPSIIQKYNPNNQDYIDE
                     LPSSDNQEYDDNSAPSGGFFVPQNDNVTQTFKINNVRAKDLIRVVELFVKSNTSKSSNV
                     LSIDGSNLLVVSAPKDILDNLPQFLSTVDLPTDQILIEGLIFEVQQGDALDFSFAAGSQ
                     RGTVAGGVNTDRLTSVLSSAGGSFGIFNGDVLGLSVRALKTNSHSKILSVPRILTLSGQ
                     KGSISVGQNVPFITGRVTGESANVNNPFQTIERQNVGISMSVFPVAMAGGNIVLDITSK
                     ADSLSSSTQASDVITNQRSIATTVNLRDGQTLLLGGLTDYKNTSQDSGVPFLSKIPLIG
                     LLFSSRSDSNEESTLYVLVKATIVRAL"
     rep_origin      5918..6780
                     /label=p15a
                     /note="p15a"
     rep_origin      complement(6135..6680)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(7229..8044)
                     /codon_start=1
                     /gene="Km"
                     /product="kanamycin resistance protein"
                     /label=Km
                     /protein_id="AEE98866.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     gene            complement(7229..8044)
                     /gene="Km"
                     /label=Km