Basic Vector Information
GAANTRY P donor luc vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
GAANTRY P donor luc vector Sequence
LOCUS 40924_979 10247 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector GAANTRY P donor luc, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 10247)
AUTHORS Collier R, Thomson JG, Thilmony R.
TITLE GAANTRY, a versatile and robust Agrobacterium-based gene stacking
system generates high quality transgenic plants
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 10247)
AUTHORS Thilmony R.
TITLE Direct Submission
JOURNAL Submitted (15-DEC-2017) Crop Improvement and Genetics research Unit,
USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA
REFERENCE 3 (bases 1 to 10247)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 10247)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-DEC-2017) Crop Improvement and Genetics research Unit,
USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..10247
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 51..72
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 87..117
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 125..141
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 149..165
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
regulatory complement(204..456)
/label=nos terminator
/note="nos terminator"
/regulatory_class="terminator"
terminator 204..456
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
CDS complement(514..2163)
/label=luciferase
/note="firefly luciferase"
CDS complement(2170..2400)
/codon_start=1
/gene="ubq"
/product="ubiquitin monomer"
/label=ubq
/note="potato ubiquitin monomer; translational fusion
confers enhanced expression"
/protein_id="AWK49540.1"
/translation="MQIFVKTLTGKTITLEVEGSDTIDNVKAEIQDKEGIPPDQQRLIF
AGKQLEDGRTLADYNIQKESTLHLVLRLRGGG"
gene complement(2170..2400)
/gene="ubq"
/label=ubq
regulatory complement(2401..3779)
/label=potato 409S ubiquitin promoter and 5' intron
/note="potato 409S ubiquitin promoter and 5' intron"
/regulatory_class="promoter"
misc_feature 3887..3942
/label=A118 attP
/note="A118 attP"
misc_feature 3979..4003
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
CDS 4335..5126
/label=KanR
/note="aminoglycoside phosphotransferase"
misc_feature 5321..5426
/label=ParA MRS
/note="ParA MRS"
primer_bind complement(5449..5465)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 5473..5489
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(5497..5527)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(5542..5563)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 5796..6241
/label=sacB promoter
/note="sacB promoter and control region"
CDS 6242..7660
/label=SacB
/note="secreted levansucrase that renders bacterial growth
sensitive to sucrose"
rep_origin complement(7761..8349)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(8523..9380)
/label=AmpR
/note="beta-lactamase"
promoter complement(9381..9485)
/label=AmpR promoter
rep_origin complement(9511..9966)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 10108..10124
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 10133..10197
/label=TP901 attP
/note="TP901 attP"
This page is informational only.