GAANTRY P donor luc vector (Cat. No.: V009971)

GAANTRY P donor luc10247 bp50010001500200025003000350040004500500055006000650070007500800085009000950010000CAP binding sitelac promoterlac operatorM13 revnos terminatorluciferaseubqpotato 409S ubiquitin promoter and 5' intronA118 attPRB T-DNA repeatKanRParA MRSM13 revlac operatorlac promoterCAP binding sitesacB promoterSacBoriAmpRAmpR promoterf1 oriM13 fwdTP901 attP
Basic Information

Note: Throughout the plasmid cultivation process, use only sucrose-free culture medium (animal-derived medium is preferred).The SacB gene, from Bacillus subtilis and related to sugar metabolism, converts sucrose to levan.

Name:
GAANTRY P donor luc
Antibiotic Resistance:
Ampicillin
Length:
10247 bp
Type:
Cloning vector
Replication origin:
ori
Source/Author:
Collier R, Thomson JG, Thilmony R.
Promoter:
sacB

GAANTRY P donor luc vector (Cat. No.: V009971) Sequence

LOCUS       40924_979       10247 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector GAANTRY P donor luc, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10247)
  AUTHORS   Collier R, Thomson JG, Thilmony R.
  TITLE     GAANTRY, a versatile and robust Agrobacterium-based gene stacking 
            system generates high quality transgenic plants
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10247)
  AUTHORS   Thilmony R.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-DEC-2017) Crop Improvement and Genetics research Unit,
            USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA
REFERENCE   3  (bases 1 to 10247)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10247)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (15-DEC-2017) Crop Improvement and Genetics research Unit, 
            USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10247
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    51..72
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        87..117
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    125..141
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     149..165
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      complement(204..456)
                     /label=nos terminator
                     /note="nos terminator"
                     /regulatory_class="terminator"
     terminator      204..456
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     CDS             complement(514..2163)
                     /label=luciferase
                     /note="firefly luciferase"
     CDS             complement(2170..2400)
                     /codon_start=1
                     /gene="ubq"
                     /product="ubiquitin monomer"
                     /label=ubq
                     /note="potato ubiquitin monomer; translational fusion
                     confers enhanced expression"
                     /protein_id="AWK49540.1"
                     /translation="MQIFVKTLTGKTITLEVEGSDTIDNVKAEIQDKEGIPPDQQRLIF
                     AGKQLEDGRTLADYNIQKESTLHLVLRLRGGG"
     gene            complement(2170..2400)
                     /gene="ubq"
                     /label=ubq
     regulatory      complement(2401..3779)
                     /label=potato 409S ubiquitin promoter and 5' intron
                     /note="potato 409S ubiquitin promoter and 5' intron"
                     /regulatory_class="promoter"
     misc_feature    3887..3942
                     /label=A118 attP
                     /note="A118 attP"
     misc_feature    3979..4003
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             4335..5126
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     misc_feature    5321..5426
                     /label=ParA MRS
                     /note="ParA MRS"
     primer_bind     complement(5449..5465)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    5473..5489
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(5497..5527)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(5542..5563)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        5796..6241
                     /label=sacB promoter
                     /note="sacB promoter and control region"
     CDS             6242..7660
                     /label=SacB
                     /note="secreted levansucrase that renders bacterial growth 
                     sensitive to sucrose"
     rep_origin      complement(7761..8349)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(8523..9380)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(9381..9485)
                     /label=AmpR promoter
     rep_origin      complement(9511..9966)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     10108..10124
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    10133..10197
                     /label=TP901 attP
                     /note="TP901 attP"

This page is informational only.