GAANTRY B helper vector (Cat. No.: V009973)
Basic Information
- Name:
- GAANTRY B helper
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6338 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Collier R, Thomson JG, Thilmony R.
GAANTRY B helper vector (Cat. No.: V009973) Sequence
LOCUS 40924_969 6338 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector GAANTRY B helper, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6338)
AUTHORS Collier R, Thomson JG, Thilmony R.
TITLE GAANTRY, a versatile and robust Agrobacterium-based gene stacking
system generates high quality transgenic plants
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 6338)
AUTHORS Thilmony R.
TITLE Direct Submission
JOURNAL Submitted (15-DEC-2017) Crop Improvement and Genetics research Unit,
USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA
REFERENCE 3 (bases 1 to 6338)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6338)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-DEC-2017) Crop Improvement and Genetics research Unit,
USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..6338
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(3..458)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 600..616
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
primer_bind 633..649
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 669..690
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 705..735
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 743..759
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
CDS 779..1447
/codon_start=1
/gene="ParA"
/product="ParA"
/label=ParA
/note="small serine site-specific recombinase"
/protein_id="AWK49527.1"
/translation="MATREQQPEGRRLKVARIYLRASTDEQNLERQESLVAATRAAGYY
VAGIYREKASGARADRPELLRMIADLQPGEVVVAEKIDRISRLPLAEAERLVASIRAKG
AKLAVPGVVDLSELAAEANGVAKIVLESVQDMLLKLALQMARDDYEDRRERQRQGVQLA
KAAGRYTGRKRDAGMHDRIIALRSGGSSIAKTAKLVGCSPSQVKRVWAAWNAQQQNKRA
"
gene 779..1447
/gene="ParA"
/label=ParA
CDS 1455..2813
/codon_start=1
/gene="A118"
/product="A118"
/label=A118
/note="A118 large serine site-specific recombinase"
/protein_id="AWK49528.1"
/translation="MKAAIYIRVSTQEQVENYSIQAQTEKLTALCRSKDWDVYDIFIDG
GYSGSNMNRPALNEMLSKLHEIDAVVVYRLDRLSRSQRDTITLIEEYFLKNNVEFVSLS
ETLDTSSPFGRAMIGILSVFAQLERETIRDRMVMGKIKRIEAGLPLTTAKGRTFGYDVI
DTKLYINEEEAKQLQLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGY
VSYKDKVHVKGIHEPIISEEQFYRVQEIFTRMGKNPNMNRDSASLLNNLVVCSKCGLGF
VHRRKDTMSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIINRVNNYSFASR
NVDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYESQIEA
NEELKKNKKIQENLADLATVDFDSLEFREKQLYLKSLINKIYIDGEQVTIEWL"
gene 1455..2813
/gene="A118"
/label=A118
regulatory 2820..2868
/label=T3 transcriptional terminator
/note="T3 transcriptional terminator"
/regulatory_class="terminator"
promoter 2888..2992
/label=AmpR promoter
CDS 3002..4081
/label=lacI
/note="lac repressor"
terminator 4084..4131
/label=T7 terminator
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
primer_bind complement(4189..4205)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4213..4229)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4237..4267)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4282..4303)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(4591..5179)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(5353..6210)
/label=AmpR
/note="beta-lactamase"
promoter complement(6211..6315)
/label=AmpR promoter
This page is informational only.