GAANTRY B donor MoroMYB vector (Cat. No.: V009977)
Basic Information
Note: Throughout the plasmid cultivation process, use only sucrose-free culture medium (animal-derived medium is preferred).The SacB gene, from Bacillus subtilis and related to sugar metabolism, converts sucrose to levan.
- Name:
- GAANTRY B donor MoroMYB
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9281 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Collier R, Thomson JG, Thilmony R.
- Promoter:
- sacB
GAANTRY B donor MoroMYB vector (Cat. No.: V009977) Sequence
LOCUS 40924_949 9281 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector GAANTRY B donor MoroMYB, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9281)
AUTHORS Collier R, Thomson JG, Thilmony R.
TITLE GAANTRY, a versatile and robust Agrobacterium-based gene stacking
system generates high quality transgenic plants
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 9281)
AUTHORS Thilmony R.
TITLE Direct Submission
JOURNAL Submitted (15-DEC-2017) Crop Improvement and Genetics research Unit,
USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA
REFERENCE 3 (bases 1 to 9281)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9281)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-DEC-2017) Crop Improvement and Genetics research Unit,
USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..9281
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory complement(7..218)
/label=CaMV 35S terminator
/note="CaMV 35S terminator"
/regulatory_class="terminator"
CDS complement(join(232..772,1568..1697,1795..1912))
/codon_start=1
/product="Moro MYBA"
/label=Moro MYBA
/note="derived from Citrus sinensis"
/protein_id="AWK49560.1"
/translation="MADSLGVRKGAWTGEEDDLLRKCIEKYGEAKWHQVPLRAGLHRCR
KSCRLRWLNYLNPNIKRGEFAADEVDLILRLHKLLGNRWSLIVGRLPGRTANDVKNFWN
THLRKKVDKCCKNNKEMKAKAEKVEKINIIKPQPRTFAKNSQWLKGKGMTSNNLQLGDY
NLGKQSTPSDHHHHHQQQQENETESVWWESFLFGDELDQQGISSSLSRPEEESTTANIF
AEKSPVVTKVTENRVIEAGQSCPTDDFAFDAELWDLLNAK"
regulatory complement(1924..3163)
/label=Arabidopsis HotHead (HTH) promoter
/note="Arabidopsis HotHead (HTH) promoter"
/regulatory_class="promoter"
misc_feature 3224..3278
/label=TP901 attB
/note="TP901 attB"
misc_feature 3300..3324
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
promoter 3483..3511
/label=Pc promoter
/note="class 1 integron promoter"
misc_feature 3552..3657
/label=ParA MRS
/note="ParA MRS"
CDS 3700..4230
/label=GmR
/note="gentamycin acetyltransferase"
misc_feature 4309..4414
/label=ParA MRS
/note="ParA MRS"
primer_bind complement(4437..4453)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4461..4477)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4485..4515)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4530..4551)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 4784..5229
/label=sacB promoter
/note="sacB promoter and control region"
CDS 5230..6648
/label=SacB
/note="secreted levansucrase that renders bacterial growth
sensitive to sucrose"
rep_origin complement(6749..7337)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(7511..8368)
/label=AmpR
/note="beta-lactamase"
promoter complement(8369..8473)
/label=AmpR promoter
rep_origin complement(8499..8954)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 9096..9112
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
This page is informational only.