GAANTRY B donor MoroMYB vector (V009977)

Basic Vector Information

      • Vector Name:
      • GAANTRY B donor MoroMYB
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 9281 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Collier R, Thomson JG, Thilmony R.

GAANTRY B donor MoroMYB vector Vector Map

GAANTRY B donor MoroMYB9281 bp400800120016002000240028003200360040004400480052005600600064006800720076008000840088009200CaMV 35S terminatorMoro MYBAArabidopsis HotHead (HTH) promoterTP901 attBRB T-DNA repeatPc promoterParA MRSGmRParA MRSM13 revlac operatorlac promoterCAP binding sitesacB promoterSacBoriAmpRAmpR promoterf1 oriM13 fwd

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

GAANTRY B donor MoroMYB vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_949        9281 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector GAANTRY B donor MoroMYB, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9281)
  AUTHORS   Collier R, Thomson JG, Thilmony R.
  TITLE     GAANTRY, a versatile and robust Agrobacterium-based gene stacking 
            system generates high quality transgenic plants
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 9281)
  AUTHORS   Thilmony R.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-DEC-2017) Crop Improvement and Genetics research Unit,
            USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA
REFERENCE   3  (bases 1 to 9281)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9281)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (15-DEC-2017) Crop Improvement and Genetics research Unit, 
            USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..9281
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      complement(7..218)
                     /label=CaMV 35S terminator
                     /note="CaMV 35S terminator"
                     /regulatory_class="terminator"
     CDS             complement(join(232..772,1568..1697,1795..1912))
                     /codon_start=1
                     /product="Moro MYBA"
                     /label=Moro MYBA
                     /note="derived from Citrus sinensis"
                     /protein_id="AWK49560.1"
                     /translation="MADSLGVRKGAWTGEEDDLLRKCIEKYGEAKWHQVPLRAGLHRCR
                     KSCRLRWLNYLNPNIKRGEFAADEVDLILRLHKLLGNRWSLIVGRLPGRTANDVKNFWN
                     THLRKKVDKCCKNNKEMKAKAEKVEKINIIKPQPRTFAKNSQWLKGKGMTSNNLQLGDY
                     NLGKQSTPSDHHHHHQQQQENETESVWWESFLFGDELDQQGISSSLSRPEEESTTANIF
                     AEKSPVVTKVTENRVIEAGQSCPTDDFAFDAELWDLLNAK"
     regulatory      complement(1924..3163)
                     /label=Arabidopsis HotHead (HTH) promoter
                     /note="Arabidopsis HotHead (HTH) promoter"
                     /regulatory_class="promoter"
     misc_feature    3224..3278
                     /label=TP901 attB
                     /note="TP901 attB"
     misc_feature    3300..3324
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     promoter        3483..3511
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     misc_feature    3552..3657
                     /label=ParA MRS
                     /note="ParA MRS"
     CDS             3700..4230
                     /label=GmR
                     /note="gentamycin acetyltransferase"
     misc_feature    4309..4414
                     /label=ParA MRS
                     /note="ParA MRS"
     primer_bind     complement(4437..4453)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(4461..4477)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4485..4515)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4530..4551)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        4784..5229
                     /label=sacB promoter
                     /note="sacB promoter and control region"
     CDS             5230..6648
                     /label=SacB
                     /note="secreted levansucrase that renders bacterial growth 
                     sensitive to sucrose"
     rep_origin      complement(6749..7337)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7511..8368)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(8369..8473)
                     /label=AmpR promoter
     rep_origin      complement(8499..8954)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     9096..9112
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"

This page is informational only.