full-length T7 TNAP vector (V009982)

Basic Vector Information

      • Vector Name:
      • full-length T7 TNAP
      • Antibiotic Resistance:
      • Kanamycin
      • Length:
      • 4969 bp
      • Type:
      • Expression vector
      • Source/Author:
      • Han T, Chen Q, Liu H.

full-length T7 TNAP vector Vector Map

full-length T7 TNAP4969 bp6001200180024003000360042004800bacterial terminatorT7 RNA polymerasehis operon terminatorKanR

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

full-length T7 TNAP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                4969 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Expression vector full-length T7 TNAP, complete sequence.
ACCESSION   KX980033
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4969)
  AUTHORS   Han T, Chen Q, Liu H.
  TITLE     Engineered photoactivatable genetic switches based on the bacterium 
            phage T7 RNA polymerase
  JOURNAL   ACS Synth Biol (2016) In press
  PUBMED    27794600
REFERENCE   2  (bases 1 to 4969)
  AUTHORS   Han T, Chen Q, Liu H.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2016) School of Life Sciences, University of 
            Science and Technology of China, University of Science and 
            Technology of China, No.96, JinZhai Road Baohe District,Hefei,Anhui,
            230026,P.R.China, Hefei, Anhui 230026, China
REFERENCE   3  (bases 1 to 4969)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Vector NTI v. Vector NTI Advance (TM) 11.0 
            Assembly Name         :: full-length T7 RNAP
            Coverage              :: 2323bp
            Sequencing Technology :: 454
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4969
                     /organism="Expression vector full-length T7 TNAP"
                     /mol_type="other DNA"
                     /db_xref="taxon:1920043"
     terminator      73..116
                     /label=bacterial terminator
                     /note="putative bacterial transcription terminator"
     regulatory      125..162
                     /regulatory_class="promoter"
     regulatory      179..190
                     /regulatory_class="ribosome_binding_site"
     RBS             179..190
                     /note="strong bacterial ribosome binding site (Elowitz and 
                     Leibler, 2000)"
     CDS             197..2848
                     /codon_start=1
                     /product="T7 RNA polymerase"
                     /label=T7 RNA polymerase
                     /protein_id="APD28466.1"
                     /translation="MNTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYE
                     MGEARFRKMFERQLKAGEVADNAAAKPLITTLLPKMIARINDWFEEVKAKRGKRPTAFQ
                     FLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRIRDLEAKHFK
                     KNVEEQLNKRVGHVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIE
                     STGMVSLHRQNAGVVGQDSETIELAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGI
                     TGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVANV
                     ITKWKHCPVEDIPAIEREELPMKPEDIDMNPEALTAWKRAAAAVYRKDKARKSRRISLE
                     FMLEQANKFANHKAIWFPYNMDWRGRVYAVSMFNPQGNDMTKGLLTLAKGKPIGKEGYY
                     WLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSPLENTWWAEQDSPFCFLAFCFE
                     YAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSETVQDIYGIVAK
                     KVNEILQADAINGTDNEVVTVTDENTGEISEKVKLGTKALAGQWLAYGVTRSVTKRSVM
                     TLAYGSKEFGFRQQVLEDTIQPAIDSGKGLMFTQPNQAAGYMAKLIWESVSVTVVAAVE
                     AMNWLKSAAKLLAAEVKDKKTGEILRKRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLG
                     QFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHEKYGIESFALIHD
                     SFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESQLDKMPALPAKGNLN
                     LRDILESDFAFA"
     regulatory      2873..2906
                     /regulatory_class="terminator"
     terminator      2927..2984
                     /label=his operon terminator
                     /note="This putative transcriptin terminator from the E. 
                     coli his operon has a 2-bp deletion introduced during 
                     synthesis. Its efficiency has not been determined."
     rep_origin      complement(3165..3778)
                     /direction=LEFT
     rep_origin      complement(3179..3767)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4000..4815)
                     /codon_start=1
                     /product="KanR"
                     /label=KanR
                     /protein_id="APD28467.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"

This page is informational only.