Cart 2

FMDV-2A-def vector (V009984#)

Basic Vector Information

Basic Vector Information
Vector Name FMDV-2A-def Length 14325 bp
Type YFV replicon vector Source Shustov AV, Frolov IV.

FMDV-2A-def vector Vector Map

5'UTR of Yellow fever virus 17D first 25 aa of Yellow fever virus 17D capsid protein green fluorescent protein (GFP) 2A protease of Foot-and-Mouth Disease Virus last 21 aa of Yellow fever virus 17D capsid protein PR of Yellow fever virus 17D M of Yellow fever virus 17D E of Yellow fever virus 17D NS1 of Yellow fever virus 17D NS2 of Yellow fever virus 17D NS3 of Yellow fever virus 17D NS4 of Yellow fever virus 17D NS5 of Yellow fever virus 17D 3'UTR of Yellow fever virus 17D antigenomic ribozyme of HDV p15A ori Bla AmpR promoter

FMDV-2A-def vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported               14325 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  YFV replicon vector FMDV-2A-def, complete sequence.
ACCESSION   DQ322634
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 14325)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Trans-packaging of Yellow Fever virus replicons: an approach for 
            flaviviral antigen production
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 14325)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2005) Department of Microbiology and Immunology, 
            University of Texas Medical Branch, 301 University Boulevard, 
            Galveston, TX 77550-1019, USA
REFERENCE   3  (bases 1 to 14325)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..14325
                     /organism="YFV replicon vector FMDV-2A-def"
                     /focus
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
                     /db_xref="taxon:364084"
     source          2..197
                     /organism="Yellow fever virus 17D"
                     /mol_type="other DNA"
                     /db_xref="taxon:11090"
     source          915..11412
                     /organism="Yellow fever virus 17D"
                     /mol_type="other DNA"
                     /db_xref="taxon:11090"
     misc_feature    2..119
                     /label=5'UTR of Yellow fever virus 17D
                     /note="5'UTR of Yellow fever virus 17D"
     misc_feature    120..194
                     /note="first 25 aa of Yellow fever virus 17D capsid 
                     protein"
     misc_feature    198..914
                     /label=green fluorescent protein (GFP)
                     /note="green fluorescent protein (GFP)"
     CDS             198..914
                     /codon_start=1
                     /product="enhanced GFP"
                     /label=EGFP
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     misc_feature    918..968
                     /label=2A protease of Foot-and-Mouth Disease Virus
                     /note="2A protease of Foot-and-Mouth Disease Virus"
     misc_feature    969..1031
                     /note="last 21 aa of Yellow fever virus 17D capsid protein"
     misc_feature    1032..1298
                     /label=PR of Yellow fever virus 17D
                     /note="PR of Yellow fever virus 17D"
     misc_feature    1299..1523
                     /label=M of Yellow fever virus 17D
                     /note="M of Yellow fever virus 17D"
     misc_feature    1524..3002
                     /label=E of Yellow fever virus 17D
                     /note="E of Yellow fever virus 17D"
     misc_feature    3003..4229
                     /label=NS1 of Yellow fever virus 17D
                     /note="NS1 of Yellow fever virus 17D"
     misc_feature    4230..5120
                     /label=NS2 of Yellow fever virus 17D
                     /note="NS2 of Yellow fever virus 17D"
     misc_feature    5121..6989
                     /label=NS3 of Yellow fever virus 17D
                     /note="NS3 of Yellow fever virus 17D"
     misc_feature    6990..8186
                     /label=NS4 of Yellow fever virus 17D
                     /note="NS4 of Yellow fever virus 17D"
     misc_feature    8187..10904
                     /label=NS5 of Yellow fever virus 17D
                     /note="NS5 of Yellow fever virus 17D"
     misc_feature    10905..11412
                     /label=3'UTR of Yellow fever virus 17D
                     /note="3'UTR of Yellow fever virus 17D"
     misc_feature    11413..11737
                     /label=antigenomic ribozyme of HDV
                     /note="antigenomic ribozyme of HDV"
     polyA_signal    11622..11703
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(12367..12911)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(13076..13936)
                     /codon_start=1
                     /product="Bla"
                     /function="ampicillin resistance"
                     /label=Bla
                     /protein_id="ABC61528.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(13937..14041)
                     /gene="bla"
                     /label=AmpR promoter
     promoter        14309..2
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"

This page is informational only.