Basic Vector Information
FMDV-2A-def vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
FMDV-2A-def vector Sequence
LOCUS Exported 14325 bp ds-DNA circular SYN 17-DEC-2018
DEFINITION YFV replicon vector FMDV-2A-def, complete sequence.
ACCESSION DQ322634
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 14325)
AUTHORS Shustov AV, Frolov IV.
TITLE Trans-packaging of Yellow Fever virus replicons: an approach for
flaviviral antigen production
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 14325)
AUTHORS Shustov AV, Frolov IV.
TITLE Direct Submission
JOURNAL Submitted (10-DEC-2005) Department of Microbiology and Immunology,
University of Texas Medical Branch, 301 University Boulevard,
Galveston, TX 77550-1019, USA
REFERENCE 3 (bases 1 to 14325)
AUTHORS .
TITLE Direct Submission
FEATURES Location/Qualifiers
source 1..14325
/organism="YFV replicon vector FMDV-2A-def"
/focus
/lab_host="Escherichia coli"
/mol_type="other DNA"
/db_xref="taxon:364084"
source 2..197
/organism="Yellow fever virus 17D"
/mol_type="other DNA"
/db_xref="taxon:11090"
source 915..11412
/organism="Yellow fever virus 17D"
/mol_type="other DNA"
/db_xref="taxon:11090"
misc_feature 2..119
/label=5'UTR of Yellow fever virus 17D
/note="5'UTR of Yellow fever virus 17D"
misc_feature 120..194
/note="first 25 aa of Yellow fever virus 17D capsid
protein"
misc_feature 198..914
/label=green fluorescent protein (GFP)
/note="green fluorescent protein (GFP)"
CDS 198..914
/codon_start=1
/product="enhanced GFP"
/label=EGFP
/note="mammalian codon-optimized"
/translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
EFVTAAGITLGMDELYK"
misc_feature 918..968
/label=2A protease of Foot-and-Mouth Disease Virus
/note="2A protease of Foot-and-Mouth Disease Virus"
misc_feature 969..1031
/note="last 21 aa of Yellow fever virus 17D capsid protein"
misc_feature 1032..1298
/label=PR of Yellow fever virus 17D
/note="PR of Yellow fever virus 17D"
misc_feature 1299..1523
/label=M of Yellow fever virus 17D
/note="M of Yellow fever virus 17D"
misc_feature 1524..3002
/label=E of Yellow fever virus 17D
/note="E of Yellow fever virus 17D"
misc_feature 3003..4229
/label=NS1 of Yellow fever virus 17D
/note="NS1 of Yellow fever virus 17D"
misc_feature 4230..5120
/label=NS2 of Yellow fever virus 17D
/note="NS2 of Yellow fever virus 17D"
misc_feature 5121..6989
/label=NS3 of Yellow fever virus 17D
/note="NS3 of Yellow fever virus 17D"
misc_feature 6990..8186
/label=NS4 of Yellow fever virus 17D
/note="NS4 of Yellow fever virus 17D"
misc_feature 8187..10904
/label=NS5 of Yellow fever virus 17D
/note="NS5 of Yellow fever virus 17D"
misc_feature 10905..11412
/label=3'UTR of Yellow fever virus 17D
/note="3'UTR of Yellow fever virus 17D"
misc_feature 11413..11737
/label=antigenomic ribozyme of HDV
/note="antigenomic ribozyme of HDV"
polyA_signal 11622..11703
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin complement(12367..12911)
/direction=LEFT
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
CDS complement(13076..13936)
/codon_start=1
/product="Bla"
/function="ampicillin resistance"
/label=Bla
/protein_id="ABC61528.1"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
promoter complement(13937..14041)
/gene="bla"
/label=AmpR promoter
promoter 14309..2
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.