Basic Vector Information
Basic Vector Information | |||
---|---|---|---|
Vector Name | DH6-2 | Length | 4282 bp |
Type | Cloning vector | Source | Huang DC, Holtz WJ, Maharbiz MM. |
DH6-2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
DH6-2 vector Sequence
LOCUS Exported 4282 bp ds-DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector DH6-2, complete sequence. ACCESSION JX155232 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4282) AUTHORS Huang DC, Holtz WJ, Maharbiz MM. TITLE A genetic bistable switch utilizing nonlinear protein degradation JOURNAL J Biol Eng 6 (1), 9 (2012) PUBMED 22776405 REFERENCE 2 (bases 1 to 4282) AUTHORS Huang DC, Holtz WJ, Maharbiz MM. TITLE Direct Submission JOURNAL Submitted (10-JUN-2012) Electrical Engineering and Computer Sciences, University of California, Berkeley, 656 Sutardja Dai Hall, Berkeley, CA 94720, USA REFERENCE 3 (bases 1 to 4282) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: GENtle v. 1.9.4 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4282 /organism="Cloning vector DH6-2" /mol_type="other DNA" /db_xref="taxon:1209495" CDS complement(49..1131) /codon_start=1 /gene="lacI" /product="lac repressor" /label=lacI /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" CDS complement(49..1008) /codon_start=1 /product="LacI" /label=LacI /protein_id="AFN88249.1" /translation="MAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSR ADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPA LFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKY LTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLR VGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVS LVKRKTTLAPNTQTASPRALADSLMQLARQVSRLESGQ" promoter complement(1132..1209) /gene="lacI" /label=lacI promoter regulatory 1500..1553 /regulatory_class="promoter" /note="pLlacO-1" protein_bind 1502..1518 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." protein_bind 1525..1541 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." 5'UTR 1569..1603 gene 1604..2401 /gene="CI" /label=CI /note="with mf degradation tag" CDS 1604..2398 /codon_start=1 /gene="CI" /product="CI with mf ssrA tag" /label=CI /protein_id="AFN88250.1" /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY PVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPD GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV VGKVIASQWPEETFGAANKNEENTNEVPTFMLNAGQANYAFA" CDS 1604..2314 /codon_start=1 /gene="cI" /product="phage lambda repressor" /label=-lambda repressor /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY PVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPD GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV VGKVIASQWPEETFG" misc_feature 2315..2395 /gene="CI" /label=mf lon degrdation tag /note="mf lon degrdation tag" regulatory 2426..2554 /regulatory_class="terminator" terminator 2434..2505 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2521..2548 /label=T7Te terminator /note="phage T7 early transcription terminator" rep_origin complement(2688..3370) /direction=LEFT /label=colE1 /note="colE1" rep_origin complement(2706..3294) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" regulatory 3376..3481 /regulatory_class="terminator" terminator 3382..3476 /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(3497..4156) /codon_start=1 /product="Cm Resistance" /label=Cm Resistance /protein_id="AFN88251.1" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(4157..4259) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.