Basic Vector Information
Basic Vector Information | |||
---|---|---|---|
Vector Name | DBH-FLPo | Antibiotic Resistance | Ampicillin |
Length | 7385 bp | Type | Cloning vector |
Source | Sun JJ, Ray R. |
DBH-FLPo vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
DBH-FLPo vector Sequence
LOCUS Exported 7385 bp ds-DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector DBH-FLPo, complete sequence. ACCESSION KX151728 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7385) AUTHORS Sun JJ, Ray R. TITLE Generation of Two Noradrenergic-Specific Dopamine-Beta-Hydroxylase-FLPo Knock-In Mice Using CRISPR/Cas9-Mediated Targeting in Embryonic Stem Cells JOURNAL PLoS ONE 11 (7), E0159474 (2016) PUBMED 27441631 REFERENCE 2 (bases 1 to 7385) AUTHORS Sun JJ, Ray R. TITLE Direct Submission JOURNAL Submitted (27-APR-2016) Neuroscience, Baylor College of Medicine, One Baylor Plaza Room T707, Houston, TX 77030, USA REFERENCE 3 (bases 1 to 7385) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..7385 /organism="Cloning vector DBH-FLPo" /mol_type="other DNA" /db_xref="taxon:1883127" rep_origin 1..827 /label=p15a origin /note="p15a origin" rep_origin 18..562 /direction=RIGHT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature 842..1838 /label=5' homology arm /note="5' homology arm" regulatory 1836..1845 /regulatory_class="other" /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" CDS 1842..3140 /codon_start=1 /product="FLPo" /label=FLPo /protein_id="ANW61888.1" /translation="MAPKKKRKVMSQFDILCKTPPKVLVRQFVERFERPSGEKIASCAA ELTYLCWMITHNGTAIKRATFMSYNTIISNSLSFDIVNKSLQFKYKTQKATILEASLKK LIPAWEFTIIPYNGQKHQSDITDIVSSLQLQFESSEEADKGNSHSKKMLKALLSEGESI WEITEKILNSFEYTSRFTKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYLGV IIQCLVTETKTSVSRHIYFFSARGRIDPLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEY QLLKDNLVRSYNKALKKNAPYPIFAIKNGPKSHIGRHLMTSFLSMKGLTELTNVVGNWS DKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPIEEWQHIEQL KGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI" regulatory 3168..3395 /regulatory_class="other" /note="bghpA" polyA_signal 3171..3395 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" misc_feature 3403..3436 /label=Lox2722 /note="Lox2722" protein_bind complement(3403..3436) /label=lox2272 /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GGATACTT). lox2272 sites are compatible with each other, but incompatible with loxP or loxN sites." regulatory 3437..3951 /regulatory_class="promoter" /note="PGK" promoter 3443..3942 /label=PGK promoter /note="mouse phosphoglycerate kinase 1 promoter" regulatory 3954..4019 /regulatory_class="promoter" /note="EM7" promoter 3954..4001 /label=EM7 promoter /note="synthetic bacterial promoter " CDS 4020..4823 /codon_start=1 /product="NeoR" /label=NeoR /protein_id="ANW61889.1" /translation="MGSAIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQ GRPVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQD LLSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDE EHQGLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQ DIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" regulatory 4837..5139 /regulatory_class="other" /note="bghpA" polyA_signal 4861..5085 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" misc_feature 5140..5173 /label=Lox2722 /note="Lox2722" protein_bind complement(5140..5173) /label=lox2272 /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GGATACTT). lox2272 sites are compatible with each other, but incompatible with loxP or loxN sites." misc_feature 5198..6197 /label=3' homology arm with deletion /note="3' homology arm with deletion" promoter 6273..6377 /gene="bla" /label=AmpR promoter CDS 6378..7238 /codon_start=1 /product="AmpR" /label=AmpR /protein_id="ANW61887.1" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW"
This page is informational only.