cp9 vector (V010034)

Basic Vector Information

      • Vector Name:
      • cp9
      • Antibiotic Resistance:
      • Gentamicin
      • Length:
      • 5473 bp
      • Type:
      • Shuttle vector
      • Source/Author:
      • Elias AF, Bono JL, Kupko JJ III, Stewart PE, Krum JG, Rosa P.

cp9 vector Vector Map

cp95473 bp60012001800240030003600420048005400ColE1Borrelia burgdorferi IR2unknownunknownunknownBorrelia burgdorferi IR1MCS-LacZ derived from pUC19FlgB promoteraacC1

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

cp9 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                5473 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Shuttle vector cp9, complete sequence.
ACCESSION   AY187049
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5473)
  AUTHORS   Elias AF, Bono JL, Kupko JJ III, Stewart PE, Krum JG, Rosa P.
  TITLE     New antibiotic resistance cassettes suitable for genetic studies in 
            Borrelia burgdorferi
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5473)
  AUTHORS   Krum JG, Bono JL, Elias AF, Rosa P.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-NOV-2002) LHBP, RML, NIAID, NIH, 903 South 4th Street,
            Hamilton, MT 59840, USA
REFERENCE   3  (bases 1 to 5473)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..5473
                     /organism="Shuttle vector cp9"
                     /lab_host="Borrelia burgdorferi"
                     /mol_type="genomic DNA"
                     /note="Borrelia burgdorferi/Escherichia coli shuttle vector
                     confering gentamicin resistance"
                     /db_xref="taxon:221493"
     rep_origin      1..714
                     /label=ColE1
                     /note="ColE1"
     rep_origin      71..659
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     repeat_region   790..973
                     /label=Borrelia burgdorferi IR2
                     /note="Borrelia burgdorferi IR2"
     CDS             complement(1178..1738)
                     /codon_start=1
                     /product="unknown"
                     /label=unknown
                     /note="Orf3; from Borrelia burgdorferi N40 plasmid cp9"
                     /protein_id="AAO62542.1"
                     /translation="MEKKRVVKVLTKKIDTYVEQNLMINESKISYYKTLKEKLNDNFKK
                     EIFHRVENIKILKEIKDNQYYKFDGYKTFLDFIKDFDVAKTQAYKYLRLATALQEGLIK
                     EDYLIENGIKNSYNFIKDKESPALKKSRQNPIKPLRFQLKTQESYDFYKKKSKFTSFMM
                     HEIFENQKDFLKKLLKKYEELKI"
     CDS             complement(1790..2341)
                     /codon_start=1
                     /product="unknown"
                     /label=unknown
                     /note="Orf2; from Borrelia burgdorferi N40 plasmid cp9"
                     /protein_id="AAO62541.1"
                     /translation="MKIGLKAARINEQKIKFPKESIFLLKEKKGDKNIYHTKILKALHR
                     VVSNKQKRCIIFFEKLLDKSEIQKLYLYPMKDGDKFLGIYYGYRKPINNVFVKYEINGV
                     ENVYTFSKIYYIEFRFKTGSVCCYLKNMRRLLRKEKIDTPYNKAIVDKFIDLEKHVYEF
                     YNKKYSSEGLILKWILKNLK"
     CDS             complement(2351..3478)
                     /codon_start=1
                     /product="unknown"
                     /label=unknown
                     /note="Orf1; from Borrelia burgdorferi N40 plasmid cp9"
                     /protein_id="AAO62540.1"
                     /translation="MENLSNINKTSKTTTCYNKLQYKLVVLISTLAYINKTYKKYTQKN
                     ILYYFNENLKRNSQTPVKLKTLQNYLYKLEKEFKVTTNYHKHLGVNLGTEIYYQLNFSK
                     KECYQKIYKYFQEKKDLRFQNRVSRGLKDRFTKNGSVDLKECLNNKNNIKEERKINEIE
                     KYQVRNYFNKCNFLCKKILSIFLTILFNLNIDKDNIIKILKIIKIIEIKLLKNKNIHFT
                     KSCMKEKQEKLKEILCNTQKEFEKNEYNSKQLETSFQKIYENYKFKPHFIIESHKYSDL
                     NNIKRKLEKSIERKKENSQQNYQDLKTNIFNILIEQLKKEVNIELLKPIIKEYLNNQKK
                     IEYNKVFCTYYCELLELMKNQKSLLSLKELNRKAI"
     repeat_region   3709..3892
                     /label=Borrelia burgdorferi IR1
                     /note="Borrelia burgdorferi IR1"
     misc_feature    4031..4491
                     /label=MCS-LacZ derived from pUC19
                     /note="MCS-LacZ derived from pUC19"
     protein_bind    4142..4163
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     promoter        4178..4208
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    4216..4232
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     4240..4256
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             4252..4500
                     /codon_start=1
                     /gene="lacZ fragment"
                     /product="LacZ-alpha fragment of beta-galactosidase"
                     /label=lacZ-alpha
                     /translation="MTMITNSSSVPGDPLESTCRHASLALAVVLQRRDWENPGVTQLNR
                     LAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRGRPR"
     misc_feature    4266..4322
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(4326..4342)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      4498..4907
                     /regulatory_class="promoter"
                     /note="FlgB promoter"
     CDS             4908..5441
                     /codon_start=1
                     /gene="aacC1"
                     /product="gentamicin acetyltransferase-3-1"
                     /label=aacC1
                     /protein_id="AAO62543.1"
                     /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
                     LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS
                     EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
                     EEVMHFDIDPSTAT"
     gene            4908..5441
                     /gene="aacC1"
                     /label=aacC1

This page is informational only.