capsid-def vector (V010041)

Basic Vector Information

      • Vector Name:
      • capsid-def
      • Length:
      • 14295 bp
      • Type:
      • YFV replicon vector
      • Source/Author:
      • Shustov AV, Frolov IV.

capsid-def vector Vector Map

capsid-def14295 bp70014002100280035004200490056006300700077008400910098001050011200119001260013300140005'UTR of Yellow fever virus 17Dfirst 25 aa of Yellow fever virus 17D capsid proteingreen fluorescent protein (GFP)last 28 aa of Yellow fever virus 17D capsid proteinPR of Yellow fever virus 17DM of Yellow fever virus 17DE of Yellow fever virus 17DNS1 of Yellow fever virus 17DNS2 of Yellow fever virus 17DNS3 of Yellow fever virus 17DNS4 of Yellow fever virus 17DNS5 of Yellow fever virus 17D3'UTR of Yellow fever virus 17Dantigenomic ribozyme of HDVp15A oriBlaAmpR promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

capsid-def vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported               14295 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  YFV replicon vector capsid-def, complete sequence.
ACCESSION   DQ322633
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 14295)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Trans-packaging of Yellow Fever virus replicons: an approach for 
            flaviviral antigen production
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 14295)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2005) Department of Microbiology and Immunology, 
            University of Texas Medical Branch, 301 University Boulevard, 
            Galveston, TX 77550-1019, USA
REFERENCE   3  (bases 1 to 14295)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..14295
                     /organism="YFV replicon vector capsid-def"
                     /focus
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
                     /db_xref="taxon:364083"
     source          2..197
                     /organism="Yellow fever virus 17D"
                     /mol_type="other DNA"
                     /db_xref="taxon:11090"
     source          915..11382
                     /organism="Yellow fever virus 17D"
                     /mol_type="other DNA"
                     /db_xref="taxon:11090"
     misc_feature    2..119
                     /label=5'UTR of Yellow fever virus 17D
                     /note="5'UTR of Yellow fever virus 17D"
     misc_feature    120..194
                     /note="first 25 aa of Yellow fever virus 17D capsid 
                     protein"
     misc_feature    198..914
                     /label=green fluorescent protein (GFP)
                     /note="green fluorescent protein (GFP)"
     CDS             198..914
                     /codon_start=1
                     /product="enhanced GFP"
                     /label=EGFP
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     misc_feature    918..1001
                     /note="last 28 aa of Yellow fever virus 17D capsid protein"
     misc_feature    1002..1268
                     /label=PR of Yellow fever virus 17D
                     /note="PR of Yellow fever virus 17D"
     misc_feature    1269..1493
                     /label=M of Yellow fever virus 17D
                     /note="M of Yellow fever virus 17D"
     misc_feature    1494..2972
                     /label=E of Yellow fever virus 17D
                     /note="E of Yellow fever virus 17D"
     misc_feature    2973..4199
                     /label=NS1 of Yellow fever virus 17D
                     /note="NS1 of Yellow fever virus 17D"
     misc_feature    4200..5090
                     /label=NS2 of Yellow fever virus 17D
                     /note="NS2 of Yellow fever virus 17D"
     misc_feature    5091..6959
                     /label=NS3 of Yellow fever virus 17D
                     /note="NS3 of Yellow fever virus 17D"
     misc_feature    6960..8156
                     /label=NS4 of Yellow fever virus 17D
                     /note="NS4 of Yellow fever virus 17D"
     misc_feature    8157..10874
                     /label=NS5 of Yellow fever virus 17D
                     /note="NS5 of Yellow fever virus 17D"
     misc_feature    10875..11382
                     /label=3'UTR of Yellow fever virus 17D
                     /note="3'UTR of Yellow fever virus 17D"
     misc_feature    11383..11707
                     /label=antigenomic ribozyme of HDV
                     /note="antigenomic ribozyme of HDV"
     polyA_signal    11592..11673
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(12337..12881)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(13046..13906)
                     /codon_start=1
                     /product="Bla"
                     /function="ampicillin resistance"
                     /label=Bla
                     /protein_id="ABC61527.1"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     promoter        complement(13907..14011)
                     /gene="bla"
                     /label=AmpR promoter
     promoter        14279..2
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"

This page is informational only.