BE4-Gam vector (V010067)

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V010067 BE4-Gam In stock, 1 week for quality controls

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
BE4-Gam
Antibiotic Resistance:
Ampicillin
Length:
9444 bp
Type:
Mammalian Expression
Replication origin:
ori
Copy Number:
High Copy
Promoter:
CMV
Cloning Method:
Gibson Cloning
5' Primer:
T7
3' Primer:
M13R

BE4-Gam vector Map

BE4-Gam9444 bp400800120016002000240028003200360040004400480052005600600064006800720076008000840088009200CMV promoterT7 promoterPutative DNA ends protecting protein gamAPOBEC-1Cas9(D10A)UGIUGISV40 NLS6xHisbGH poly(A) signalM13 revlac operatorlac promoterCAP binding siteL4440oriAmpRAmpR promoterpRS-markerCMV enhancer

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

BE4-Gam vector Sequence

LOCUS       V010067                 9444 bp    DNA     circular SYN 13-MAY-2021
DEFINITION  Exported.
ACCESSION   V010067
VERSION     V010067
KEYWORDS    BE4-Gam
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 9444)
  AUTHORS   Komor AC, Zhao KT, Packer MS, Gaudelli NM, Waterbury AL, Koblan LW,
            Kim YB, Badran AH, Liu DR
  TITLE     Improved base excision repair inhibition and bacteriophage Mu Gam
            protein yields C:G-to-T:A base editors with higher efficiency and
            product purity.
  JOURNAL   Sci Adv. 2017 Aug 30;3(8):eaao4774. doi: 10.1126/sciadv.aao4774.
            eCollection 2017 Aug.
   PUBMED   28875174
REFERENCE   2  (bases 1 to 9444)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 9444)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Sci Adv.";
            date: "2017-08-30"; pages: "
            10.1126/sciadv.aao4774. eCollection 2017 Aug"
            SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9444
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        132..335
                     /label="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     promoter        377..395
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             409..930
                     /gene="gam"
                     /label="Putative DNA ends protecting protein gam"
                     /note="Putative DNA ends protecting protein gam from
                     Escherichia phage Mu. Accession#: P06023"
     CDS             979..1662
                     /label="APOBEC-1"
                     /note="cytidine deaminase (C to U editing enzyme) from rat"
     CDS             1759..5859
                     /label="Cas9(D10A)"
                     /note="nickase mutant of the Cas9 endonuclease from the
                     Streptococcus pyogenes Type II CRISPR/Cas system"
     CDS             5890..6138
                     /label="UGI"
                     /note="uracil-DNA glycosylase inhibitor from a Bacillus
                     subtilis bacteriophage (Mol et al., 1995)"
     CDS             6169..6417
                     /codon_start=1
                     /product="uracil-DNA glycosylase inhibitor from a Bacillus
                     subtilis bacteriophage (Mol et al., 1995)"
                     /label="UGI"
                     /translation="TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTA
                     YDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML"
     CDS             6430..6450
                     /label="SV40 NLS"
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     CDS             6459..6476
                     /label="6xHis"
                     /note="6xHis affinity tag"
     polyA_signal    6505..6729
                     /label="bGH poly(A) signal"
                     /note="bovine growth hormone polyadenylation signal"
     primer_bind     complement(6800..6816)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(6824..6840)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6848..6878)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(6893..6914)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     primer_bind     complement(7031..7048)
                     /label="L4440"
                     /note="L4440 vector, forward primer"
     rep_origin      complement(7202..7790)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(7964..8821)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(8822..8926)
                     /label="AmpR promoter"
     primer_bind     complement(9005..9024)
                     /label="pRS-marker"
                     /note="pRS vectors, use to sequence yeast selectable
                     marker"
     enhancer        9196..9444
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"