Aqp3a_WT-Strep vector (V010113)

Basic Vector Information

      • Vector Name:
      • Aqp3a_WT-Strep
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 5310 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Eskova A, Chauvigne F, Maischein HM, Ammelburg M, Cerda J, Nusslein-Volhard C, Irion U.

Aqp3a_WT-Strep vector Vector Map

Aqp3a_WT-Strep5310 bp6001200180024003000360042004800CMV enhancerwt Aqp3a-beta-globin poly(A) signalAmpR promoterAmpRori

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

Aqp3a_WT-Strep vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                5310 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector Aqp3a_WT-Strep, complete sequence.
ACCESSION   KY379154
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5310)
  AUTHORS   Eskova A, Chauvigne F, Maischein HM, Ammelburg M, Cerda J, 
            Nusslein-Volhard C, Irion U.
  TITLE     Gain-of-function mutations of mau/DrAqp3a influence zebrafish 
            pigment pattern formation through the tissue environment
  JOURNAL   Development (2017) In press
  PUBMED    28506994
REFERENCE   2  (bases 1 to 5310)
  AUTHORS   Eskova A.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-DEC-2016) e-CNV group, Max Planck Institute for 
            Developmental Biology, Spemannstr. 35-39, Tuebingen 72076, Germany
REFERENCE   3  (bases 1 to 5310)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..5310
                     /organism="Cloning vector Aqp3a_WT-Strep"
                     /mol_type="other DNA"
                     /db_xref="taxon:2005674"
     enhancer        42..421
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     regulatory      57..625
                     /regulatory_class="promoter"
                     /note="CMV promoter"
     promoter        422..625
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     CDS             1182..2159
                     /codon_start=1
                     /product="Aqp3a-Strep fusion"
                     /label=Aqp3a-Strep fusion
                     /note="wt Aqp3a"
                     /protein_id="ARU79052.1"
                     /translation="MGWQKSVLDKLAQTFQIRNKLLRQGLAECLGTLILVMFGCGSLAQ
                     LKLSEGSHGLFLTANLAFGFGATLGILVCGQVSGGHLNPAVTFALCLLGREKWRKFPVY
                     FLFQTLGSFLGAAIIFAEYHDAIYDYAGESNELLVLGEKETAGIFATYPSKYLTPLNGF
                     FDQVIGTASLIVCILAIVDPYNNPIPQGLEAFTVGFSVLIIGLSMGFNSGYAVNPARDF
                     GPRLFTAMAGWGSEVFTARDYWFLVPIFAPFIGAVIGVIVYQLMVGWHVEGEARDKKAK
                     AREEVMNLNDVASKELNSSLGSGWSHPQFEKTGHHHHHHHHGGQ"
     CDS             2094..2117
                     /codon_start=1
                     /product="peptide that binds Strep-Tactin(R), an engineered
                     form of streptavidin"
                     /label=Strep-Tag II
                     /translation="WSHPQFEK"
     CDS             2124..2147
                     /codon_start=1
                     /product="8xHis affinity tag"
                     /label=8xHis
                     /translation="HHHHHHHH"
     polyA_site      2186..2241
                     /label=-beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal"
     promoter        3410..3514
                     /gene="bla"
                     /label=AmpR promoter
     CDS             3515..4375
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      4546..5134
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.