Basic Vector Information
Aqp3a_tXGU1-Strep vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
Aqp3a_tXGU1-Strep vector Sequence
LOCUS 40924_280 5310 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector Aqp3a_tXGU1-Strep, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5310) AUTHORS Eskova A, Chauvigne F, Maischein HM, Ammelburg M, Cerda J, Nusslein-Volhard C, Irion U. TITLE Gain-of-function mutations of mau/DrAqp3a influence zebrafish pigment pattern formation through the tissue environment JOURNAL Development (2017) In press PUBMED 28506994 REFERENCE 2 (bases 1 to 5310) AUTHORS Eskova A. TITLE Direct Submission JOURNAL Submitted (21-DEC-2016) e-CNV group, Max Planck Institute for Developmental Biology, Spemannstr. 35-39, Tuebingen 72076, Germany REFERENCE 3 (bases 1 to 5310) TITLE Direct Submission REFERENCE 4 (bases 1 to 5310) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Development (2017) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-DEC-2016) e-CNV group, Max Planck Institute for Developmental Biology, Spemannstr. 35-39, Tuebingen 72076, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5310 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 42..421 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 422..625 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 2094..2117 /codon_start=1 /label=Strep-Tag II /note="peptide that binds Strep-Tactin(R), an engineered form of streptavidin" /translation="WSHPQFEK" CDS 2124..2147 /codon_start=1 /label=8xHis /note="8xHis affinity tag" /translation="HHHHHHHH" polyA_signal 2186..2241 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" promoter 3410..3514 /label=AmpR promoter CDS 3515..4372 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 4546..5134 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.