AbVec-hIgKappa vector (V010128)

Basic Vector Information

      • Vector Name:
      • AbVec-hIgKappa
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 5074 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Di Niro R, Mesin L, Raki M, Zheng NY, Lund-Johansen F, Lundin KE, Charpilienne A, Poncet D, Wilson PC, Sollid LM.

AbVec-hIgKappa vector Vector Map

AbVec-hIgKappa5074 bp6001200180024003000360042004800CMVSP6 promotermurine IgG1 signal peptide; derived from DEC205/immunoglobluin gamma fusion protein in GenBank Accession Number DQ407610IgKappavertebrate consensus sequence for strong initiation of translation (Kozak, 1987)SV40 poly(A) signalSV40 promoterM13 fwdf1 oriAmpR promoterAmp_Resorilac promoterlac operatorM13 rev

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

AbVec-hIgKappa vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                5074 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector AbVec-hIgKappa, complete sequence.
ACCESSION   FJ475056
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5074)
  AUTHORS   Di Niro R, Mesin L, Raki M, Zheng NY, Lund-Johansen F, Lundin KE, 
            Charpilienne A, Poncet D, Wilson PC, Sollid LM.
  TITLE     Rapid Generation of Rotavirus-Specific Human Monoclonal Antibodies 
            from Small-Intestinal Mucosa
  JOURNAL   J. Immunol. 185 (9), 5377-5383 (2010)
  PUBMED    20935207
REFERENCE   2  (bases 1 to 5074)
  AUTHORS   Wilson PC.
  TITLE     Ig-kappa expression vector for expression-cloning of antibody 
            variable region genes
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 5074)
  AUTHORS   Wilson PC, Wilson PC, Wilson PC.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-NOV-2008) Medicine/Rheumatology, The University of 
            Chicago, BSLC/JFK Bldg. 924 East 57th St., Rm 414, Chicago, IL 
            60637, USA
REFERENCE   4  (bases 1 to 5074)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..5074
                     /organism="Cloning vector AbVec-hIgKappa"
                     /mol_type="other DNA"
                     /db_xref="taxon:583343"
     regulatory      1..618
                     /regulatory_class="promoter"
                     /note="CMV"
     enhancer        14..393
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        394..597
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     promoter        828..846
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     misc_feature    929..973
                     /note="murine IgG1 signal peptide; derived from 
                     DEC205/immunoglobluin gamma fusion protein in GenBank 
                     Accession Number DQ407610"
     CDS             989..1311
                     /codon_start=1
                     /gene="IgKappa"
                     /product="Igkappa constant region"
                     /label=IgKappa
                     /note="derived from Homo sapiens"
                     /protein_id="ACK87038.1"
                     /translation="VRWLHHLSSSSRHLMSS*NLELPLLCAC*ITSIPERPKYSGRWIT
                     PSNRVTPRRVSQSRTARTAPTASAAP*R*AKQTTRNTKSTPAKSPIRA*ARPSQRASTG
                     ESV"
     gene            989..1311
                     /gene="IgKappa"
                     /label=IgKappa
     regulatory      1319..1328
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     polyA_signal    1332..1466
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     promoter        1539..1896
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     rep_origin      1747..1882
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     primer_bind     complement(1916..1932)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      2145..2600
                     /direction=RIGHT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     promoter        2932..3036
                     /gene="bla"
                     /label=AmpR promoter
     CDS             3037..3897
                     /codon_start=1
                     /gene="Amp_Res"
                     /product="beta-lactamase"
                     /label=Amp_Res
                     /note="confers resistance to ampicillin"
                     /protein_id="ACK87039.1"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRDDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     gene            3037..3897
                     /gene="Amp_Res"
                     /label=Amp_Res
     rep_origin      4068..4656
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     promoter        4980..5010
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    5018..5034
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     5042..5058
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"

This page is informational only.