NovoPro
Cart 2

'pure' split-T7P564 vector

Basic Vector Information

Basic Vector Information
Vector Name 'pure' split-T7P564 Antibiotic Resistance Kanamycin
Length 5016 bp Type Expression vector
Source Han T, Chen Q, Liu H.

'pure' split-T7P564 vector Vector Map

'pure' split-T7P564 vector Sequence

Copy Sequence

Download SnapGene Map(.dna)

Download GeneBank File(.gb)

LOCUS       Exported                5016 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Expression vector 'pure' split-T7P564, complete sequence.
ACCESSION   KX980037
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5016)
  AUTHORS   Han T, Chen Q, Liu H.
  TITLE     Engineered photoactivatable genetic switches based on the bacterium 
            phage T7 RNA polymerase
  JOURNAL   ACS Synth Biol (2016) In press
  PUBMED    27794600
REFERENCE   2  (bases 1 to 5016)
  AUTHORS   Han T, Chen Q, Liu H.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2016) School of Life Sciences, University of 
            Science and Technology of China, University of Science and 
            Technology of China, No.96, JinZhai Road Baohe District,Hefei,Anhui,
            230026,P.R.China, Hefei, Anhui 230026, China
REFERENCE   3  (bases 1 to 5016)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Dec 18, 2018 from SnapGene 4.1.8
            http://www.snapgene.com
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Vector NTI v. Vector NTI Advance (TM) 11.0 
            Assembly Name         :: ""pure"" split-T7P564
            Coverage              :: 5016bp
            Sequencing Technology :: 454
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5016
                     /organism="Expression vector 'pure' split-T7P564"
                     /mol_type="other DNA"
                     /db_xref="taxon:1920041"
     terminator      73..116
                     /label=bacterial terminator
                     /note="putative bacterial transcription terminator"
     regulatory      125..162
                     /regulatory_class="promoter"
     regulatory      179..190
                     /regulatory_class="ribosome_binding_site"
     RBS             179..190
                     /note="strong bacterial ribosome binding site (Elowitz and 
                     Leibler, 2000)"
     CDS             197..1891
                     /codon_start=1
                     /product="N564"
                     /label=N564
                     /note="N564 fragment of T7 RNAP"
                     /protein_id="APD28476.1"
                     /translation="MNTINIAKNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYE
                     MGEARFRKMFERQLKAGEVADNAAAKPLITTLLPKMIARINDWFEEVKAKRGKRPTAFQ
                     FLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGRAIEDEARFGRIRDLEAKHFK
                     KNVEEQLNKRVGHVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIE
                     STGMVSLHRQNAGVVGQDSETIELAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGI
                     TGGGYWANGRRPLALVRTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVANV
                     ITKWKHCPVEDIPAIEREELPMKPEDIDMNPEALTAWKRAAAAVYRKDKARKSRRISLE
                     FMLEQANKFANHKAIWFPYNMDWRGRVYAVSMFNPQGNDMTKGLLTLAKGKPIGKEGYY
                     WLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSPLENTWWAEQDSPFCFLAFCFE
                     YAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPS"
     regulatory      1933..1944
                     /regulatory_class="ribosome_binding_site"
     RBS             1933..1944
                     /note="strong bacterial ribosome binding site (Elowitz and 
                     Leibler, 2000)"
     CDS             1951..2913
                     /codon_start=1
                     /product="C565"
                     /label=C565
                     /note="C565 fragment of T7 RNAP"
                     /protein_id="APD28477.1"
                     /translation="METVQDIYGIVAKKVNEILQADAINGTDNEVVTVTDENTGEISEK
                     VKLGTKALAGQWLAYGVTRSVTKRSVMTLAYGSKEFGFRQQVLEDTIQPAIDSGKGLMF
                     TQPNQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAAKLLAAEVKDKKTGEILRKRCAVH
                     WVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHS
                     QDGSHLRKTVVWAHEKYGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLAD
                     FYDQFADQLHESQLDKMPALPAKGNLNLRDILESDFAFA"
     regulatory      2920..2953
                     /regulatory_class="terminator"
     terminator      2974..3031
                     /label=his operon terminator
                     /note="This putative transcriptin terminator from the E. 
                     coli his operon has a 2-bp deletion introduced during 
                     synthesis. Its efficiency has not been determined."
     rep_origin      complement(3212..3825)
                     /direction=LEFT
     rep_origin      complement(3226..3814)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4047..4862)
                     /codon_start=1
                     /product="KanR"
                     /label=KanR
                     /protein_id="APD28478.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"

This page is informational only.