Basic Vector Information
- Vector Name:
- pPICZA-EGFP
- Antibiotic Resistance:
- Bleomycin
- Length:
- 4040 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Yeast
- Selection Marker:
- Zeo
- Promoter:
- AOX1
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pPICZA-EGFP vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPICZA-EGFP vector Sequence
LOCUS 62056_18500 4040 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4040) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..4040 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 2..940 /label=AOX1 promoter /note="inducible promoter, regulated by methanol" CDS 1000..1716 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" CDS 1768..1785 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 1864..2110 /label=AOX1 terminator /note="transcription terminator for AOX1" promoter 2125..2536 /label=TEF1 promoter /note="promoter for EF-1-alpha" promoter 2544..2591 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 2610..2981 /codon_start=1 /label=BleoR /note="antibiotic-binding protein" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" terminator 3050..3297 /label=CYC1 terminator /note="transcription terminator for CYC1" rep_origin complement(3372..3960) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.