Basic Vector Information
- Vector Name:
- pLac-DsRed2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4240 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- E. coli
- Promoter:
- Lac
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pLac-DsRed2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLac-DsRed2 vector Sequence
LOCUS 62056_13655 4240 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4240) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..4240 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 33..54 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 69..99 /label=lac promoter /note="promoter for the E. coli lac operon" CDS 230..904 /codon_start=1 /label=DsRed2 /note="improved tetrameric variant of DsRed fluorescent protein" /translation="MASSENVITEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVK LKVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGV ATVTQDSSLQDGCFIYKVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGETHK ALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDAKLDITSHNEDYTIVEQYERTEGRHH LFL" polyA_signal 1028..1149 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1156..1611) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1638..1742 /label=AmpR promoter promoter 1744..2101 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2136..2927 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3162..3209 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 3538..4126 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.