Basic Vector Information
- Vector Name:
- pMA0911
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7215 bp
- Type:
- Protein expression, Secretory expression
- Replication origin:
- ori
- Host:
- Bacillus subtilis
- Promoter:
- Hpall
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pMA0911 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMA0911 vector Sequence
LOCUS 62056_16440 7215 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7215) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..7215 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 251..299 /label=fd terminator /note="central terminator from bacteriophage fd (Otsuka and Kunisawa, 1982)" rep_origin 537..992 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1018..1122 /label=AmpR promoter misc_feature 1307..1686 /label=ISS /note="immunostimulatory sequence from the AmpR gene; contains unmethylated CpG dinucleotides in the context of 5'-AACGTT-3' (Sato et al., 1996)" rep_origin 2155..2746 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 3034..3055 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter complement(3516..3618) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 4157..5158 /codon_start=1 /label=repB /note="RepB replication protein" /translation="MGVSFNIMCPNSSIYSDEKSRVLVDKTKSGKVRPWREKKIANVDY FELLHILEFKKAERVKDCAEILEYKQNRETGERKLYRVWFCKSRLCPMCNWRRAMKHGI QSQKVVAEVIKQKPTVRWLFLTLTVKNVYDGEELNKSLSDMAQGFRRMMQYKKINKNLV GFMRATEVTINNKDNSYNQHMHVLVCVEPTYFKNTENYVNQKQWIQFWKKAMKLDYDPN VKVQMIRPKNKYKSDIQSAIDETAKYPVKDTDFMTDDEEKNLKRLSDLEEGLHRKRLIS YGGLLKEIHKKLNLDDTEEGDLIHTDDDEKADEDGFSIIAMWNWERKNYFIKE"
This page is informational only.