Basic Vector Information
- Vector Name:
- pMV261-6×His
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4506 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Mycobacterium tuberculosis
- Promoter:
- HSP60
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pMV261-6×His vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMV261-6×His vector Sequence
LOCUS 62056_17605 4506 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4506) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..4506 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 121..933 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPHAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHNLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1268..1856 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 4363..4380 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 4424..4470 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.