Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V012970 | pAdEasy-1 | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
pAdEasy-1 is an adenoviral vector plasmid derived from human adenovirus serotype 5 (Ad5), with the E1 and E3 genes deleted to accommodate foreign DNA inserts of up to 7.5 kb. It has a plasmid size of 33,477 bp and carries an ampicillin resistance gene for prokaryotic selection.
- Vector Name:
- pAdEasy-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 33477 bp
- Type:
- Packaging assistance
- Replication origin:
- ori
- Host:
- Mammalian cells, Adenovirus
- Source/Author:
- Tong-Chuan He
- Copy Number:
- Low
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 30℃
pAdEasy-1 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- He TC, Zhou S, da Costa LT, Yu J, Kinzler KW, Vogelstein B. A simplified system for generating recombinant adenoviruses. Proc Natl Acad Sci U S A. 1998 Mar 3;95(5):2509-14. doi: 10.1073/pnas.95.5.2509. PMID: 9482916; PMCID: PMC19394.
pAdEasy-1 vector Sequence
LOCUS Exported 33477 bp DNA circular UNA 18-JUL-2025
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE natural DNA sequence
ORGANISM unspecified
REFERENCE 1 (bases 1 to 33477)
AUTHORS .
TITLE Direct Submission
FEATURES Location/Qualifiers
source 1..33477
/mol_type="genomic DNA"
/organism="unspecified"
source join(27380..33477,1..27379)
/mol_type="genomic DNA"
/organism="unspecified"
source 27382..28091
/mol_type="genomic DNA"
/organism="unspecified"
source 27382..28091
/mol_type="genomic DNA"
/organism="unspecified"
source 27382..28091
/mol_type="genomic DNA"
/organism="unspecified"
source 27382..28091
/mol_type="genomic DNA"
/organism="unspecified"
misc_feature 1584..1687
/label=Ad SA
/note="adenovirus major late transcript splice acceptor
(Friedrich and Soriano, 1991)"
CDS complement(3125..5128)
/gene="PTP"
/label=PTP
/note="Preterminal protein from Human adenovirus C serotype
5. Accession#: P04499"
CDS 5587..6831
/gene="L1"
/label=L1
/note="Packaging protein 3 from Human adenovirus C serotype
5. Accession#: P04496"
CDS 6855..8609
/note="Pre-hexon-linking protein IIIa from Human adenovirus
C serotype 5. Accession#: P12537"
CDS 8693..10405
/gene="L2"
/label=L2
/note="Penton protein from Human adenovirus C serotype 5.
Accession#: P12538"
CDS 10415..11008
/gene="L2"
/label=L2
/note="Pre-histone-like nucleoprotein from Human adenovirus
C serotype 2. Accession#: P68950"
CDS 11081..12184
/gene="L2"
/label=L2
/note="Core-capsid bridging protein from Human adenovirus C
serotype 5. Accession#: P24938"
CDS 12215..12454
/note="Pre-core protein X from Human adenovirus C serotype
5. Accession#: Q2KS10"
CDS 12540..13289
/gene="L3"
/label=L3
/note="Pre-protein VI from Human adenovirus C serotype 5.
Accession#: P24937"
CDS 13378..16233
/gene="L3"
/label=L3
/note="Hexon protein from Human adenovirus C serotype 5.
Accession#: P04133"
CDS 16269..16880
/gene="L3"
/label=L3
/note="Protease from Human adenovirus C serotype 5.
Accession#: P03253"
CDS complement(16982..18568)
/codon_start=1
/gene="DBP"
/label=DBP
/note="DNA-binding protein from Human adenovirus C serotype
5. Accession#: P03265"
/translation="MASREEEQRETTPERGRGAARRPPTMEDVSSPSPSPPPPRAPPKK
RMRRRIESEDEEDSSQDALVPRTPSPRPSTSAADLAIAPKKKKKRPSPKPERPPSPEVI
VDSEEEREDVALQMVGFSNPPVLIKHGKGGKRTVRRLNEDDPVARGMRTQEEEEEPSEA
ESEITVMNPLSVPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTW
LNEEHRGLQLTFTSNKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGE
LKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCV
HDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECN
SKPGHAPFLGRQLPKLTPFALRNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYRNS
RAQGGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPV
AHSDARQNPFDF"
CDS 18597..21017
/gene="L4"
/label=L4
/note="Shutoff protein from Human adenovirus C serotype 5.
Accession#: P24933"
CDS 21704..22384
/gene="L4"
/label=L4
/note="Pre-hexon-linking protein VIII from Human adenovirus
C serotype 5. Accession#: P24936"
CDS 22939..24681
/note="Fiber protein from Human adenovirus C serotype 5.
Accession#: P11818"
CDS complement(25093..25974)
/note="Early 4 ORF6 protein from Human adenovirus C
serotype 2. Accession#: P03239"
CDS complement(26253..26600)
/note="Early 4 ORF3 protein from Human adenovirus C
serotype 2. Accession#: P03241"
repeat_region 27733..27835
/label=ITR
/note="inverted terminal repeat of human adenovirus
serotype 5"
CDS 29126..29317
/codon_start=1
/gene="rop"
/product="Rop protein, which maintains plasmids at low copy
number"
/label=rop
/translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
DELYRSCLARFGDDGENL"
misc_feature 29419..29559
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(29745..30333)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(30504..31364)
/codon_start=1
/gene="bla"
/product="beta-lactamase"
/label=AmpR
/note="confers resistance to ampicillin, carbenicillin, and
related antibiotics"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
[TEM beta-lactamase fragment, 59 aa]
LIKHW"
promoter complement(31365..31469)
/label=AmpR promoter
CDS 31625..32044
/gene="IX"
/label=IX
/note="Hexon-interlacing protein from Human adenovirus C
serotype 5. Accession#: P03281"
CDS complement(32110..33444)
/gene="IVa2"
/label=IVa2
/note="Packaging protein 1 from Human adenovirus C serotype
5. Accession#: P03271"
CDS complement(join(33216..33477,1..3323))
/gene="POL"
/label=POL
/note="DNA polymerase from Human adenovirus C serotype 2.
Accession#: P03261"