Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012806 | pKEW303-AcrVA5 | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
Expresses AcrVA5 in bacteria, under TetR control.
pKEW303-AcrVA5 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pKEW303-AcrVA5 vector Sequence
LOCUS pKEW303-AcrVA5. 3198 bp DNA circular SYN 31-AUG-2022 DEFINITION Expresses AcrVA5 in bacteria, under TetR control.. ACCESSION . VERSION . KEYWORDS pKEW303-AcrVA5. SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3198) AUTHORS Watters KE, Fellmann C, Bai HB, Ren SM, Doudna JA TITLE Systematic discovery of natural CRISPR-Cas12a inhibitors. JOURNAL Science. 2018 Oct 12;362(6411):236-239. doi: 10.1126/science.aau5138. Epub 2018 Sep 6. PUBMED 30190307 REFERENCE 2 (bases 1 to 3198) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; doi: "10.1126/science.aau5138"; journalName: "Science"; date: "2018-10-12- 12"; volume: "362"; issue: "6411"; pages: "236-239" FEATURES Location/Qualifiers source 1..3198 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 1..56 /label=tetR/tetA promoters /note="overlapping promoters for bacterial tetR and tetA" CDS 83..361 /codon_start=1 /label=anti-CRISPR N-acetyltransferase AcrVA5 /note="anti-CRISPR N-acetyltransferase AcrVA5" /translation="MKIELSGGYICYSIEEDEVTIDMVEVTTKRQGIGSQLIDMVKDVA REVGLPIGLYAYPQDDSISQEDLIEFYFSNDFEYDPDDVDGRLMRWS" terminator 594..621 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" rep_origin complement(747..1335) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1509..2366) /label=AmpR /note="beta-lactamase" promoter complement(2367..2471) /label=AmpR promoter CDS complement(2560..3183) /label=TetR /note="tetracycline repressor TetR"