RNAi-Ready pSIREN-RetroQ-DsRed-Express vector (V012741)

Basic Vector Information

      • Vector Name:
      • RNAi-Ready pSIREN-RetroQ-DsRed-Express
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 6543 bp
      • Type:
      • RNAi
      • Source/Author:
      • Clontech
      • Selection Marker:
      • DsRed
      • Copy Number:
      • Low copy number
      • Promoter:
      • U6
      • Expression Method:
      • Transient

RNAi-Ready pSIREN-RetroQ-DsRed-Express vector Vector Map

RNAi-Ready pSIREN-RetroQ-DsRed-Express6543 bp300600900120015001800210024002700300033003600390042004500480051005400570060006300CMV enhancerCMV promoterDsRed-Express3' LTR (Delta-U3)SV40 promoteroriAmpRAmpR promoterCMV enhancerCMV promoter5' LTR (truncated)MMLV Psigag (truncated)U6 promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

RNAi-Ready pSIREN-RetroQ-DsRed-Express vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                6543 bp ds-DNA     circular SYN 11-SEP-2021
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled 2
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6543)
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6543
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     enhancer        66..369
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        370..573
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     CDS             618..1295
                     /codon_start=1
                     /product="rapidly maturing tetrameric variant of DsRed 
                     fluorescent protein (Bevis and Glick, 2002)"
                     /note="DsRed-Express"
                     /note="mammalian codon-optimized"
                     /translation="MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAK
                     LKVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGV
                     VTVTQDSSLQDGSFIYKVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGEIHK
                     ALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDSKLDITSHNEDYTIVEQYERAEGRHH
                     LFL"
     LTR             1415..1840
                     /note="3' LTR (Delta-U3)"
                     /note="self-inactivating 3' long terminal repeat (LTR) from
                     Moloney murine leukemia virus"
     promoter        2106..2435
                     /note="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     rep_origin      2286..2421
                     /note="SV40 ori"
                     /note="SV40 origin of replication"
     rep_origin      complement(2728..3316)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3487..4347)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(4348..4452)
                     /gene="bla"
                     /note="AmpR promoter"
     enhancer        4638..5017
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        5018..5221
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     LTR             5222..5397
                     /note="5' LTR (truncated)"
                     /note="truncated long terminal repeat from Moloney murine 
                     sarcoma virus"
     misc_feature    5460..5659
                     /note="MMLV Psi"
                     /note="packaging signal of Moloney murine leukemia virus 
                     (MMLV)"
     CDS             5860..6276
                     /note="gag (truncated)"
                     /note="truncated Moloney murine leukemia virus (MMLV) gag 
                     gene lacking the start codon"
     promoter        6300..6540
                     /note="U6 promoter"
                     /note="RNA polymerase III promoter for human U6 snRNA"

This page is informational only.