pAAV-hSyn-GRAB_DA1h vector (V012732)

MSDS

Basic Vector Information

express the genetically-encoded fluorescent dopamine(DA) sensor GRAB_DA1h in neurons

Vector Name:: pAAV-hSyn-GRAB_DA1h

Antibiotic Resistance:: Ampicillin

Length:: 6349 bp

Type:: Viral Expression & Packaging Vectors

Replication origin:: ori

Source/Author:: Yulong Li

Copy Number:: High copy number

Promoter:: human synapsin

Expression Method:: Constiutive, Stable

pAAV-hSyn-GRAB_DA1h vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pAAV-hSyn-GRAB_DA1h vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       pAAV-hSyn-GRAB_D        6349 bp DNA     circular SYN 09-APR-2021
DEFINITION  natural circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    pAAV-hSyn-GRAB_DA1h.
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6349)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 6349)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6349
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     repeat_region   1..141
                     /label=AAV2 ITR
                     /note="inverted terminal repeat of adeno-associated virus 
                     serotype 2"
     promoter        156..597
                     /note="synapsin"
     CDS             598..660
                     /codon_start=1
                     /product="leader sequence from mouse immunoglobulin kappa
                     light chain"
                     /label=leader sequence from mouse immunoglobulin kappa
                     /note="Ig-kappa leader"
                     /translation="METDTLLLWVLLLWVPGSTGD"
     protein_bind    661..685
                     /gene="mutant version of attB"
                     /label=BP Clonase(TM) binding site
                     /bound_moiety="BP Clonase(TM)"
                     /note="attB1"
                     /note="recombination site for the Gateway(R) BP reaction"
     CDS             694..1446
                     /codon_start=1
                     /label=D(2) dopamine receptor(2-252)
                     /note="D(2) dopamine receptor(2-252)"
                     /translation="DPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIA
                     VIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRI
                     HCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSF
                     TISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVMLLVYIKIYIVLRRRRKRV
                     NTKRSSRAFRAHLRAPLKGNCTHPEDMKL"
     CDS             1471..1722
                     /label=VC155
                     /note="C-terminal fragment of mVenus for use in bimolecular
                     fluorescence complementation (BiFC) (Kodama and Hu, 2010)"
     CDS             2191..2451
                     /codon_start=1
                     /label=D(2) dopamine receptor(358-443)
                     /note="D(2) dopamine receptor(358-443)"
                     /translation="MSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCN
                     IPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC"
     misc_feature    2476..3064
                     /label=WPRE
                     /note="woodchuck hepatitis virus posttranscriptional
                     regulatory element"
     polyA_signal    3096..3572
                     /label=hGH poly(A) signal
                     /note="human growth hormone polyadenylation signal"
     repeat_region   3612..3752
                     /label=AAV2 ITR
                     /note="inverted terminal repeat of adeno-associated virus 
                     serotype 2"
     rep_origin      3827..4282
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        4564..4668
                     /label=AmpR promoter
     CDS             4669..5526
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      5700..6288
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.