pTrc99a vector (V012683) Gene synthesis in pTrc99a backbone

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V012683 pTrc99a In stock, instant shipping

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Tightly regulated trc promoter vectors useful for the expression of unfused and fused proteins in Escherichia coli

Vector Name:
pTrc99a
Antibiotic Resistance:
Ampicillin
Length:
4175 bp
Type:
Bacterial expression vector
Replication origin:
ori
Copy Number:
High copy number
Promoter:
trc
Cloning Method:
Enzyme Cut
5' Primer:
GAGCGGATAACAATTTCACACAGG
3' Primer:
GATTTAATCTGTATCAGG
Growth Strain(s):
stbl3
Growth Temperature:
37℃
Expression Method:
IPTG induced

pTrc99a vector Map

pTrc99a4175 bp60012001800240030003600trc promoterlac operatorMCSrrnB T1 terminatorrrnB T2 terminatorAmpR promoterAmpRoribomlacIq promoterlacI

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Dai G, Li R, Chen H, Jiang C, You X, Wu Y. A ferritin-like protein with antioxidant activity in Ureaplasma urealyticum. BMC Microbiol. 2015 Jul 26;15:145. doi: 10.1186/s12866-015-0485-6. PMID: 26209240; PMCID: PMC4515015.
  • Xu J, Xu X, Xu Q, Zhang Z, Jiang L, Huang H. Efficient production of lycopene by engineered E. coli strains harboring different types of plasmids. Bioprocess Biosyst Eng. 2018 Apr;41(4):489-499. doi: 10.1007/s00449-017-1883-y. Epub 2018 Jan 8. PMID: 29313097.
  • Jeon E, Lee S, Won JI, Han SO, Kim J, Lee J. Development of Escherichia coli MG1655 strains to produce long chain fatty acids by engineering fatty acid synthesis (FAS) metabolism. Enzyme Microb Technol. 2011 Jun 10;49(1):44-51. doi: 10.1016/j.enzmictec.2011.04.001. Epub 2011 Apr 8. PMID: 22112270.

pTrc99a vector Sequence

LOCUS       Exported                4175 bp DNA     circular SYN 26-AUG-2024
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4175)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 4175)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 4175)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
COMMENT     SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4175
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        193..222
                     /label=trc promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    230..246
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     misc_feature    270..326
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     terminator      529..615
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      707..734
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        754..844
                     /label=AmpR promoter
     CDS             845..1702
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      1876..2464
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(2650..2790)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     promoter        2976..3053
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     CDS             3054..4133
                     /codon_start=1
                     /label=lacI
                     /note="lac repressor"
                     /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
                     NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
                     EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
                     EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
                     MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
                     YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
                     ALADSLMQLARQVSRLESGQ"