Basic Vector Information
Low Ampicillin
5'UTR CGG 99x FMR1-EGFP vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
5'UTR CGG 99x FMR1-EGFP vector Sequence
LOCUS 40924_95 4688 bp DNA circular SYN 13-MAY-2021 DEFINITION Contains expanded CGG repeats (99 repeats) within the 5'UTR of FMR1 as found in the Fragile X Tremor Ataxia Syndrome (FXTAS). These repeats are in frame with EGFP.. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4688) TITLE Charlet-Berguerand plasmids JOURNAL Unpublished REFERENCE 2 (bases 1 to 4688) TITLE Direct Submission REFERENCE 3 (bases 1 to 4688) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..4688 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(1..105) /label=AmpR promoter primer_bind 173..191 /label=pBRforEco /note="pBR322 vectors, upsteam of EcoRI site, forward primer" enhancer 356..734 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 735..938 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" promoter 983..1001 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 1625..2338 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITLGMDELYK" polyA_signal complement(2372..2493) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" primer_bind complement(2637..2659) /label=pGEX 3' /note="pGEX vectors, reverse primer" misc_feature 2743..2883 /label=bom /note="basis of mobility region from pBR322" primer_bind complement(2898..2915) /label=L4440 /note="L4440 vector, forward primer" rep_origin complement(3069..3657) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3831..4688) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW"
This page is informational only.