5'UTR CGG 99x FMR1-EGFP vector (V000024)

Price Information

Cat No. Plasmid Name Availability Add to cart
V000024 5'UTR CGG 99x FMR1-EGFP In stock, 1 week for quality controls

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Low Ampicillin

Vector Name:
5'UTR CGG 99x FMR1-EGFP
Antibiotic Resistance:
Ampicillin
Length:
4688 bp
Type:
Mammalian Expression
Replication origin:
ori
Promoter:
CMV
5' Primer:
CMV-F

5'UTR CGG 99x FMR1-EGFP vector Vector Map

5'UTR CGG 99x FMR1-EGFP4688 bp600120018002400300036004200AmpR promoterpBRforEcoCMV enhancerCMV promoterT7 promoterEGFPSV40 poly(A) signalpGEX 3'bomL4440oriAmpR

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

5'UTR CGG 99x FMR1-EGFP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_95        4688 bp DNA     circular SYN 13-MAY-2021
DEFINITION  Contains expanded CGG repeats (99 repeats) within the 5'UTR of FMR1 
            as found in the Fragile X Tremor Ataxia Syndrome (FXTAS). These 
            repeats are in frame with EGFP..
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4688)
  TITLE     Charlet-Berguerand plasmids
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4688)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 4688)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4688
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        complement(1..105)
                     /label=AmpR promoter
     primer_bind     173..191
                     /label=pBRforEco
                     /note="pBR322 vectors, upsteam of EcoRI site, forward
                     primer"
     enhancer        356..734
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        735..938
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     promoter        983..1001
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             1625..2338
                     /codon_start=1
                     /label=EGFP
                     /note="enhanced GFP"
                     /translation="VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
                     FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG
                     NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV
                     NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
                     FVTAAGITLGMDELYK"
     polyA_signal    complement(2372..2493)
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(2637..2659)
                     /label=pGEX 3'
                     /note="pGEX vectors, reverse primer"
     misc_feature    2743..2883
                     /label=bom
                     /note="basis of mobility region from pBR322"
     primer_bind     complement(2898..2915)
                     /label=L4440
                     /note="L4440 vector, forward primer"
     rep_origin      complement(3069..3657)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3831..4688)
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"