pEcgRNA vector (Cat. No.: V000012)
Note: pEcgRNA is a component of the pEcCas/pEcgRNA CRISPR-Cas9 system, a plasmid vector designed for genome editing in Escherichia coli. It serves as the sgRNA expression vector, containing a site for inserting a target-specific guide RNA (gRNA) sequence. The plasmid has a high-copy-number backbone derived from pTargetF, is approximately 3.1 kb in size, and carries a spectinomycin resistance gene (Spect+) for selection in bacteria. It is used in conjunction with the pEcCas plasmid to enable precise gene knock-out or knock-in editing in E. coliand other microorganisms.
- Name:
- pEcgRNA
- Antibiotic Resistance:
- Spectinomycin
- Length:
- 3134 bp
- Type:
- Bacterial Expression
- Replication origin:
- ori
- Source/Author:
- Sheng Yang
- Copy Number:
- High Copy
- Promoter:
- J23119(SpeI)
- Cloning Method:
- Ligation Independent Cloning
- Growth Strain(s):
- DB3.1
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Li Q, Sun B, Chen J, Zhang Y, Jiang Y, Yang S. A modified pCas/pTargetF system for CRISPR-Cas9-assisted genome editing in Escherichia coli. Acta Biochim Biophys Sin (Shanghai). 2021 Apr 15;53(5):620-627. doi: 10.1093/abbs/gmab036. PMID: 33764372.
pEcgRNA vector (Cat. No.: V000012) Sequence
LOCUS 40924_16775 3134 bp DNA circular SYN 13-MAY-2021
DEFINITION CRISPR-Cas9-assisted genome editing in Escherichia coli.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3134)
AUTHORS Li , Q i, Sun, Bingbing, Chen, Jun, Zhang, Yiwen, Jiang, Y u Jiang,
Yang, Sheng
TITLE A modified pCas/pTargetF system for CRISPR-Cas9-assisted genome
editing in Escherichia coli
JOURNAL Acta Biochimica et Biophysica Sinica, 2021
REFERENCE 2 (bases 1 to 3134)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 3134)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Acta
Biochimica et Biophysica Sinica, 2021"
COMMENT SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3134
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 45..62
/label=L4440
/note="L4440 vector, forward primer"
promoter 139..173
/label=J23119(SpeI) promoter
/note="bacterial promoter (Registry of Standard Biological
Parts BBa_J23119) modified to end with an SpeI site"
CDS complement(563..865)
/codon_start=1
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
/translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
misc_RNA 1211..1286
/label=gRNA scaffold
/note="guide RNA scaffold for the Streptococcus pyogenes
CRISPR/Cas9 system"
CDS 1472..2260
/codon_start=1
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
/translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
rep_origin 2437..3025
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"