Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012144 | pTargetF | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
The pTargetF is for constitutive expression of sgRNA without donor editing template DNA.
pTargetF vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
References
- Jiang Y, Chen B, Duan C, Sun B, Yang J, Yang S. Multigene editing in the Escherichia coli genome via the CRISPR-Cas9 system. Appl Environ Microbiol. 2015 Apr;81(7):2506-14. doi: 10.1128/AEM.04023-14. Epub 2015 Jan 30. Erratum in: Appl Environ Microbiol. 2016 Jun 15;82(12):3693.
pTargetF vector Sequence
LOCUS 40924_42689 2117 bp DNA circular SYN 13-MAY-2021 DEFINITION Constitutive expression of sgRNA without donor editing template DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2117) AUTHORS Jiang Y, Chen B, Duan C, Sun B, Yang J, Yang S TITLE Multigene editing in the Escherichia coli genome using the CRISPR-Cas9 system. JOURNAL Appl Environ Microbiol. 2015 Jan 30. pii: AEM.04023-14. PUBMED 25636838 REFERENCE 2 (bases 1 to 2117) TITLE Direct Submission REFERENCE 3 (bases 1 to 2117) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl Environ Microbiol. 2015 Jan 30. pii: AEM.04023-14." COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..2117 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 98..115 /label=L4440 /note="L4440 vector, forward primer" promoter 192..226 /label=J23119(SpeI) promoter /note="bacterial promoter (Registry of Standard Biological Parts BBa_J23119) modified to end with an SpeI site" misc_RNA 247..322 /label=gRNA scaffold /note="guide RNA scaffold for the Streptococcus pyogenes CRISPR/Cas9 system" CDS 508..1296 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 1473..2061 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"