CFP-C1-PLCdelta-PH vector (V000461)

MSDS

Basic Vector Information

- - Vector Name:
  - CFP-C1-PLCdelta-PH
- - Antibiotic Resistance:
  - Kanamycin
- - Length:
  - 5229 bp
- - Type:
  - Mammalian Expression
- - Replication origin:
  - ori
- - Selection Marker:
  - Neomycin (select with G418)
- - Promoter:
  - CMV
- - Cloning Method:
  - Restriction Enzyme

CFP-C1-PLCdelta-PH vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

CFP-C1-PLCdelta-PH vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_455        5229 bp DNA     circular SYN 13-MAY-2021
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5229)
  AUTHORS   Botelho RJ, Teruel M, Dierckman R, Anderson R, Wells A, York JD, 
            Meyer T, Grinstein S
  TITLE     Localized biphasic changes in phosphatidylinositol-4,5-bisphosphate 
            at sites of phagocytosis.
  JOURNAL   J Cell Biol. 2000 Dec 25. 151(7):1353-68.
  PUBMED    11134066
REFERENCE   2  (bases 1 to 5229)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 5229)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J Cell 
            Biol. 2000 Dec 25. 151(7):1353-68."
COMMENT     SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5229
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        61..364
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        365..568
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     CDS             598..1314
                     /codon_start=1
                     /label=CFP
                     /note="cyan variant of GFP"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHRFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIK
                     AHFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     misc_feature    1315..1371
                     /label=MCS
                     /note="multiple cloning site"
     polyA_signal    2017..2138
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(2145..2600)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        2627..2731
                     /label=AmpR promoter
     promoter        2733..3090
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     CDS             3125..3916
                     /codon_start=1
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     primer_bind     complement(4107..4126)
                     /label=TK-pA-R
                     /note="Thymidine kinase polyA, reverse primer"
     polyA_signal    4151..4198
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      4527..5115
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.