FUW mCherry-GFP-LC3 vector (Cat. No.: V000678)

FUW mCherry-GFP-LC311138 bp500100015002000250030003500400045005000550060006500700075008000850090009500100001050011000CMV enhancerCMV promoter5' LTR (truncated)HIV-1 PsiRREgp41 peptideProtein TatcPPT/CTSUbC promotermCherryattB1EGFPLC3BWPREKS primer5' LTR (truncated)bGH poly(A) signalf1 oriSV40 promoterEM7 promoterBleoRSV40 poly(A) signalM13/pUC Reverselac promoterCAP binding siteL4440oriAmpRAmpR promoterpRS-marker
Basic Information

Note: The FUW mCherry-GFP-LC3 contains GFP and mCherry fluorescence. It can to observe free autophagosomes and autophagosomes fused to lysosomes (autolysosomes; mCherry fluorescence only because GFP is acid sensitive).

Name:
FUW mCherry-GFP-LC3
Antibiotic Resistance:
Ampicillin
Length:
11138 bp
Type:
Lentiviral
Replication origin:
ori
Promoter:
UbC
Cloning Method:
TOPO Cloning
5' Primer:
CGCGGATCCGGTCGCCACCATGGTGAGCAAGGGCGAG
3' Primer:
CGCGGCGCGCCGCTGGGTCTAGATGCATGC
Growth Strain(s):
stbl3
Growth Temperature:
37℃
$ 198.5
In stock, instant shipping
Buy one, get one free! (?)
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Leeman DS, Hebestreit K, Ruetz T, Webb AE, McKay A, Pollina EA, Dulken BW, Zhao X, Yeo RW, Ho TT, Mahmoudi S, Devarajan K, Passegué E, Rando TA, Frydman J, Brunet A. Lysosome activation clears aggregates and enhances quiescent neural stem cell activation during aging. Science. 2018 Mar 16;359(6381):1277-1283.

FUW mCherry-GFP-LC3 vector (Cat. No.: V000678) Sequence

LOCUS       V000678                11138 bp    DNA     circular SYN 13-MAY-2021
DEFINITION  Exported.
ACCESSION   V000678
VERSION     V000678
KEYWORDS    FUW mCherry-GFP-LC3
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 11138)
  AUTHORS   Leeman DS, Hebestreit K, Ruetz T, Webb AE, McKay A, Pollina EA,
            Dulken BW, Zhao X, Yeo RW, Ho TT, Mahmoudi S, Devarajan K, Passegue
            E, Rando TA, Frydman J, Brunet A
  TITLE     Lysosome activation clears aggregates and enhances quiescent neural
            stem cell activation during aging.
  JOURNAL   Science. 2018 Mar 16;359(6381):1277-1283. doi:
            10.1126/science.aag3048. Epub 2018 Mar 15.
   PUBMED   29590078
REFERENCE   2  (bases 1 to 11138)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 11138)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; doi:
            "10.1126/science.aag3048"; journalName: "Science"; date:
            "2018-03-16- 16"; volume: "359"; issue: "6381"; pages: "1277-1283"
            SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..11138
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        7..386
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        387..589
                     /label="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     LTR             604..784
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     misc_feature    831..956
                     /label="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus
                     type 1"
     misc_feature    1449..1682
                     /label="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for
                     Rev-dependent mRNA export from the nucleus to the
                     cytoplasm."
     CDS             1867..1911
                     /label="gp41 peptide"
                     /note="antigenic peptide corresponding to amino acids 655
                     to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
                     al., 2013)"
     CDS             2060..2101
                     /note="Protein Tat from Human immunodeficiency virus type 1
                     group M subtype B (isolate WMJ22). Accession#: P12509"
                     /label="Protein Tat"
     misc_feature    2209..2326
                     /label="cPPT/CTS"
                     /note="central polypurine tract and central termination
                     sequence of HIV-1"
     promoter        2391..3602
                     /label="UbC promoter"
                     /note="human ubiquitin C promoter"
     CDS             3647..4354
                     /label="mCherry"
                     /note="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
     protein_bind    4382..4406
                     /label="attB1"
                     /note="recombination site for the Gateway(R) BP reaction"
     CDS             4421..5137
                     /label="EGFP"
                     /note="enhanced GFP"
     CDS             5165..5539
                     /codon_start=1
                     /gene="MAP1LC3B"
                     /product="human LC3 protein"
                     /label="LC3B"
                     /note="Atg8 family member found on autophagosomes"
                     /translation="MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLP
                     VLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKD
                     EDGFLYMVYASQETFGMKLSV"
     misc_feature    5599..6187
                     /label="WPRE"
                     /note="woodchuck hepatitis virus posttranscriptional
                     regulatory element"
     primer_bind     complement(6190..6206)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     complement(6191..6207)
                     /label="pBluescriptKS"
                     /note="For pBluescript vector"
     LTR             6712..6892
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     polyA_signal    6924..7148
                     /label="bGH poly(A) signal"
                     /note="bovine growth hormone polyadenylation signal"
     rep_origin      7194..7622
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        7636..7965
                     /label="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     promoter        8013..8060
                     /label="EM7 promoter"
                     /note="synthetic bacterial promoter"
     CDS             8079..8450
                     /label="BleoR"
                     /note="antibiotic-binding protein"
     polyA_signal    8583..8716
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(8753..8769)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     complement(8753..8769)
                     /label="M13 Reverse"
                     /note="In lacZ gene. Also called M13-rev"
     primer_bind     complement(8766..8788)
                     /label="M13/pUC Reverse"
                     /note="In lacZ gene"
     protein_bind    8777..8793
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(8801..8831)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(8846..8867)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     primer_bind     complement(8984..9001)
                     /label="L4440"
                     /note="L4440 vector, forward primer"
     rep_origin      complement(9155..9743)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(9917..10774)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(10775..10879)
                     /label="AmpR promoter"
     primer_bind     complement(10954..10973)
                     /label="pRS-marker"
                     /note="pRS vectors, use to sequence yeast selectable
                     marker"