pAX01 vector (Cat. No.: V000803)
Note: pAX01 is a versatile integrative expression vector specifically designed for targeted gene insertion and regulated expression in Bacillus subtilis. It features a modular structure that enables flexible replacement of key components, including its integration arms, expression cassettes, and selectable markers—for instance, the erythromycin resistance gene (erm) can be removed via NotI digestion, and the xylose-inducible expression cassette (with the PxylA promoter and xylR repressor) can be excised using SacI. This vector targets the lacA locus of Bacillus subtilis (a weakly expressed gene encoding β-galactosidase) for stable DNA integration through double-crossover homologous recombination, ensuring minimal interference with host physiological functions. To prevent readthrough transcription, its xylose-inducible cassette is fused to the t0 transcription terminator from phage DNA, resulting in tight regulation: no target gene expression is detected without xylose, while full induction is achieved with 0.5% xylose, and sustained high-level expression can be maintained with 2% xylose. Notably, pAX01 is a non-replicating vector in Bacillus subtilis (lacking replication elements for this host) and relies on the ColE1 replicon for propagation in E. coli. It also carries an ampicillin resistance gene (bla) for selection in E. coli and an erythromycin resistance gene (erm) for identifying integrants in Bacillus subtilis, making it a robust tool for controlled gene expression studies in this bacterium.
- Name:
- pAX01
- Antibiotic Resistance:
- Ampicillin, Erythromycin
- Length:
- 7784 bp
- Type:
- Bacillus subtilis expression vectors
- Replication origin:
- ori
- Selection Marker:
- Erythromycin
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Härtl B, Wehrl W, Wiegert T, Homuth G, Schumann W. 2001. Development of a New Integration Site within the Bacillus subtilis Chromosome and Construction of Compatible Expression Cassettes. J Bacteriol 183:.https://doi.org/10.1128/jb.183.8.2696-2699.2001
pAX01 vector (Cat. No.: V000803) Sequence
LOCUS pAX01 7784 bp DNA circular SYN 26-DEC-2025
DEFINITION Exported.
ACCESSION V000803
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7784)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 7784)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 7784)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7784)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7784
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 7..522
/codon_start=1
/product="beta-galactosidase GanA [Bacillus subtilis]"
/label=lacA'
/note="beta-galactosidase GanA [Bacillus subtilis]"
/translation="MSKLEKTHVTKAKFMLHGGDYNPDQWLDRPDILADDIKLMKLSHT
NTFSVGIFAWSALEPEEGVYQFEWLDDIFERIHSIGGRVILATPSGARPAWLSQTYPEV
LRVNASRVKQLHGGRHNHCLTSKVYREKTRHINRLLAERYGHHPALLMWHISNEYGGDC
HCESMRPL"
terminator 546..580
/note="lambda t0 terminator"
/note="minimal transcription terminator from phage lambda
(Scholtissek and Grosse, 1987)"
terminator complement(660..687)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(706..792)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
CDS complement(969..1703)
/gene="ermBP"
/label=rRNA adenine N-6-methyltransferase
/note="rRNA adenine N-6-methyltransferase from Enterococcus
faecalis. Accession#: P0A4D5"
promoter 2083..2187
/label=AmpR promoter
CDS 2523..3647
/codon_start=1
/product="transcriptional repressor"
/label=XylR
/translation="MNQKLILDEILKNSPVSRATLSEITGLNKSTVSSQVNTLLEKDFI
FEIGAGQSRGGRRPVMLVFNKNAGYSIGIDIGVDYLNGILTDLEGNIILEKTSDLSSSS
ASEVKEILFALIHGFVTHMPESPYGLVGIGICVPGLVDRHQQIIFMPNLNWNIKDLQFL
IESEFNVPVFVENEANAGAYGEKVFGMTKNYENIVYISINIGIGTGLVINNELYKGVQG
FSGEMGHMTIDFNGPKCSCGNRGCWELYASEKALLASLSKEEKNISRKEIVERANKNDV
EMLNALQNFGFYIGIGLTNILNTFDIEAVILRNHIIESHPIVLNTIKNEVSSRVHSHLD
NKCELLPSSLGKNAPALGAVSIVIDSFLSVTPIS"
terminator complement(3679..3713)
/label=lambda t0 terminator
/note="minimal transcription terminator from phage lambda
(Scholtissek and Grosse, 1987)"
CDS 3839..4246
/codon_start=1
/product="beta-galactosidase GanA [Bacillus subtilis]"
/label='lacA
/translation="MKDYATVIDVKTASVEAVYQEDFYARTPAVTSHEYQQGKAYFIGA
RLEDQFQRDFYEGLITDLSLSPVFPVRHGKGVSVQARQDQDNDYIFVMNFTEEKQLVTF
DQSVKDIMTGDILSGDLTMEKYEVRIVVNTH"
promoter 4357..4461
/gene="bla"
/label=bla promoter
/note="AmpR promoter"
CDS 4462..5319
/label=AmpR
/note="beta-lactamase"
rep_origin 5493..6081
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(6267..6407)
/label=bom
/note="basis of mobility region from pBR322"
CDS complement(6512..6700)
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"