Pveg vector (V011644)

Basic Vector Information

      • Vector Name:
      • Pveg
      • Antibiotic Resistance:
      • Chloramphenicol
      • Length:
      • 2307 bp
      • Type:
      • Synthetic Biology ; Bacillus BioBrick Box
      • Copy Number:
      • High Copy
      • Promoter:
      • veg
      • Cloning Method:
      • Restriction Enzyme
      • 5' Primer:
      • na

Pveg vector Vector Map

Pveg2307 bp60012001800his operon terminatorL4440orilambda t0 terminatorCmRpBRforEcobacterial terminatorBioBrick prefixBioBrick suffix

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

Pveg vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                2307 bp ds-DNA     circular SYN 13-MAY-2021
DEFINITION  Very strong constitutive promoter.
ACCESSION   .
VERSION     .
KEYWORDS    Pveg
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 2307)
  AUTHORS   Radeck J, Kraft K, Bartels J, Cikovic T, Durr F, Emenegger J, 
            Kelterborn S, Sauer C, Fritz G, Gebhard S, Mascher T
  TITLE     The Bacillus BioBrick Box: generation and evaluation of essential 
            genetic building blocks for standardized work with Bacillus 
            subtilis.
  JOURNAL   J Biol Eng. 2013 Dec 2;7(1):29. doi: 10.1186/1754-1611-7-29.
  PUBMED    24295448
REFERENCE   2  (bases 1 to 2307)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J Biol 
            Eng."; date: "2013-12-2"; volume: "7(1):29. doi"; pages: " 
            10.1186/1754-1611-7-29"
FEATURES             Location/Qualifiers
     source          1..2307
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     terminator      2..59
                     /label=his operon terminator
                     /note="This putative transcriptin terminator from the E. 
                     coli his operon has a 2-bp deletion introduced during 
                     synthesis. Its efficiency has not been determined."
     primer_bind     complement(83..100)
                     /label=L4440
                     /note="L4440 vector, forward primer"
     rep_origin      complement(254..842)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     primer_bind     complement(334..353)
                     /label=pBR322ori-F
                     /note="pBR322 origin, forward primer"
     terminator      1025..1119
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     CDS             complement(1140..1799)
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /label=CmR
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     primer_bind     1714..1733
                     /label=CAT-R
                     /note="Chloramphenicol resistance gene, reverse primer"
     primer_bind     1961..1979
                     /label=pBRforEco
                     /note="pBR322 vectors, upsteam of EcoRI site, forward 
                     primer"
     terminator      1983..2026
                     /label=bacterial terminator
                     /note="putative bacterial transcription terminator"
     misc_feature    2029..2050
                     /label=BioBrick prefix
                     /note="BioBrick prefix for parts that do not start with 
                     ""ATG"""
     misc_feature    join(2288..2307,1)
                     /label=BioBrick suffix
                     /note="universal suffix for all parts"

This page is informational only.