pSPL3 vector (V001167) Gene synthesis in pSPL3 backbone

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V001167 pSPL3 In stock, instant shipping

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

The pSPL3 vector is designed for exon trapping and splicing analysis. One of its key features is the presence of splice acceptor and donor sites that facilitate the detection of alternative splicing events. pSPL3 offers several advantages, such as high efficiency in capturing exons and providing insights into gene structure and function. It is ideal for researchers studying splicing regulation, identifying novel exons, and characterizing gene variants. When investigating complex splicing patterns or looking for potential disease-causing mutations related to splicing, pSPL3 is a valuable choice.

Vector Name:
pSPL3
Antibiotic Resistance:
Ampicillin
Length:
6031 bp
Type:
Cloning vectors
Replication origin:
ori
Growth Strain(s):
DH10B
Growth Temperature:
37℃

pSPL3 vector Map

pSPL36031 bp30060090012001500180021002400270030003300360039004200450048005100540057006000SV40 promoterhalf BstXISDgp160SV40 poly(A) signalAmpR promoterAmpRori

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Pousada G, Lupo V, Cástro-Sánchez S, Álvarez-Satta M, Sánchez-Monteagudo A, Baloira A, Espinós C, Valverde D. Molecular and functional characterization of the BMPR2 gene in Pulmonary Arterial Hypertension. Sci Rep. 2017 May 15;7(1):1923. doi: 10.1038/s41598-017-02074-8. PMID: 28507310; PMCID: PMC5432510.
  • Church DM, Stotler CJ, Rutter JL, Murrell JR, Trofatter JA, Buckler AJ. Isolation of genes from complex sources of mammalian genomic DNA using exon amplification. Nat Genet. 1994 Jan;6(1):98-105. doi: 10.1038/ng0194-98. PMID: 8136842.

pSPL3 vector Sequence

LOCUS       Exported                6031 bp DNA     circular SYN 21-SEP-2024
DEFINITION  Exported.
ACCESSION   V001167
VERSION     .
KEYWORDS    pSPL3
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6031)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 6031)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 6031)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6031)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
COMMENT     SGRef: number: 2; type: "Journal Article"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6031
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        10..339
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     misc_feature    693..698
                     /label=half BstXI
     misc_feature    699..707
                     /label=SD
                     /note="donr site
                     "
     CDS             715..957
                     /gene="vpu"
                     /label=Protein Vpu
                     /note="Protein Vpu from Human immunodeficiency virus type 1
                     group M subtype B (isolate BH10). Accession#: P69699"
     CDS             875..3262
                     /codon_start=1
                     /product="gp160"
                     /label=HIV envelope protein gp160
                     /note="HIV gp160"
                     /translation="MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVRDH
                     QNSGARAAAAGSQISGDPVPVWKEATTTLFCASDAKAYDTEVHNVWATHAGVPTDPNPQ
                     EVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTN
                     SSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYTLTSCNTSV
                     ITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQL
                     LLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKKIRIQRGPGRAFV
                     TIGKIGNMRQAHCNISRAKWNATLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFN
                     CGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQFINMWQEVGKAMYA
                     PPISGQIRCSSNITGLLLTRDGGNNNNGSEIFRPGGGDMRDNWRSELYKYKVVKIEPLG
                     VAPTKAKRRVVQREKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNN
                     LLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLLCTTAVPWNAS
                     WSNKSLEQIWNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNW
                     FNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTWRSPEGTRQARR
                     NRRRRWRERQRQIHFDQFTPQVQAAYQKVVAGVANALAHKYH"
     misc_feature    3083..3094
                     /label=SA
                     /note="acceptor site"
     misc_feature    3095..3100
                     /label=half BstXI
     polyA_signal    complement(3263..3397)
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     promoter        4071..4175
                     /label=AmpR promoter
     CDS             4176..5033
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      5207..5795
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"