35S:RUBY vector (Cat. No.: V001191)
Note: RUBY reporter converts tyrosine to vividly red betalain, which is clearly visible to naked eyes without the need of using special equipment or chemical treatments. Tyrosine is first hydroxylated on the benzene ring, resulting in L-3,4-dihydroxyphenylalanine (L-DOPA). The reaction is catalyzed by the P450 oxygenase CYP76AD1. L-DOPA can be further oxidized into cyclo-DOPA by CYP76AD1. Alternatively, L-DOPA is catalyzed by L-DOPA 4,5-dioxygenase (DODA) into betalamic acid, which is subsequently condensed with cyclo-DOPA into betanidin. The condensation reaction does not require an enzyme. Finally, a sugar moiety is added to betanidin by a glucosyltransferase to generate the colorful betalain. CYP76AD1, DODA, and Glucosyltransferase were organized into a single open reading frame to form the RUBY reporter and the three genes were linked by sequences that encode 2A peptides.
- Name:
- 35S:RUBY
- Antibiotic Resistance:
- Spectinomycin
- Length:
- 14335 bp
- Type:
- Plant Expression
- Replication origin:
- ori
- Host:
- Plants
- Promoter:
- CaMV 35S (enhanced)
- Cloning Method:
- Gibson Cloning
- 5' Primer:
- CCTGTCAAACACTGATAGTTTtgagacttttcaacaaagggt
- 3' Primer:
- GCTTACTCAGTTAGGTCTAGCTTATCTTTAATCATATTCCATAGTCCA
- Growth Strain(s):
- Stbl3
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- He, Y., Zhang, T., Sun, H. et al. A reporter for noninvasively monitoring gene expression and plant transformation. Hortic Res 7, 152 (2020). https://doi.org/10.1038/s41438-020-00390-1
35S:RUBY vector (Cat. No.: V001191) Sequence
LOCUS V001191 14335 bp DNA circular SYN 25-DEC-2023
DEFINITION Exported.
ACCESSION V001191
VERSION V001191
KEYWORDS 35S:RUBY
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 14335)
AUTHORS He Y, Zhang T, Sun H, Zhan H, Zhao Y
TITLE A reporter for noninvasively monitoring gene expression and plant
transformation.
JOURNAL Hortic Res. 2020 Sep 19;7:152. doi: 10.1038/s41438-020-00390-1.
eCollection 2020.
PUBMED 33024566
REFERENCE 2 (bases 1 to 14335)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 14335)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Hortic
Res."; date: "2020-09-19"
SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..14335
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 32..708
/label="CaMV 35S promoter (enhanced)"
/note="cauliflower mosaic virus 35S promoter with a
duplicated enhancer region"
CDS 717..2207
/gene="CYP76AD1"
/label="Cytochrome P450 76AD1"
/note="Cytochrome P450 76AD1 from Beta vulgaris.
Accession#: I3PFJ5"
CDS 2217..2273
/codon_start=1
/product="2A peptide from porcine teschovirus-1
polyprotein"
/label="P2A"
/note="Eukaryotic ribosomes fail to insert a peptide bond
between the Gly and Pro residues, yielding separate
polypeptides."
/translation="ATNFSLLKQAGDVEENPGP"
CDS 2274..3098
/codon_start=1
/label="4,5-DOPA dioxygenase extradiol alpha 1"
/translation="MKMMNGEDANDQMIKESFFITHGNPILTVEDTHPLRPFFETWREK
IFSKKPKAILIISGHWETVKPTVNAVHINDTIHDFDDYPAAMYQFKYPAPGEPELARKV
EEILKKSGFETAETDQKRGLDHGAWVPLMLMYPEADIPVCQLSVQPHLDGTYHYNLGRA
LAPLKNDGVLIIGSGSATHPLDETPHYFDGVAPWAAAFDSWLRKALINGRFEEVNIYES
KAPNWKLAHPFPEHFYPLHVVLGAAGEKWKAELIHSSWDHGTLCHGSYKFTSA"
CDS 3108..3164
/codon_start=1
/product="2A peptide from porcine teschovirus-1
polyprotein"
/label="P2A"
/note="Eukaryotic ribosomes fail to insert a peptide bond
between the Gly and Pro residues, yielding separate
polypeptides."
/translation="ATNFSLLKQAGDVEENPGP"
CDS 3165..4667
/codon_start=1
/label="cyclo-DOPA 5-O-glucosyltransferase"
/translation="MTAIKMNTNGEGETQHILMIPFMAQGHLRPFLELAMFLYKRSHVI
ITLLTTPLNAGFLRHLLHHHSYSSSGIRIVELPFNSTNHGLPPGIENTDKLTLPLVVSL
FHSTISLDPHLRDYISRHFSPARPPLCVIHDVFLGWVDQVAKDVGSTGVVFTTGGAYGT
SAYVSIWNDLPHQNYSDDQEFPLPGFPENHKFRRSQLHRFLRYADGSDDWSKYFQPQLR
QSMKSFGWLCNSVEEIETLGFSILRNYTKLPIWGIGPLIASPVQHSSSDNNSTGAEFVQ
WLSLKEPDSVLYISFGSQNTISPTQMMELAAGLESSEKPFLWVIRAPFGFDINEEMRPE
WLPEGFEERMKVKKQGKLVYKLGPQLEILNHESIGGFLTHCGWNSILESLREGVPMLGW
PLAAEQAYNLKYLEDEMGVAVELARGLEGEISKEKVKRIVEMILERNEGSKGWEMKNRA
VEMGKKLKDAVNEEKELKGSSVKAIDDFLDAVMQAKLEPSLQ"
terminator 4675..4923
/label="HSP terminator"
/note="efficient transcription terminator from the
Arabidopsis thaliana heat shock protein 18.2 gene (Nagaya
et al., 2010)"
promoter 5403..5586
/label="NOS promoter"
/note="nopaline synthase promoter"
CDS 5638..6648
/label="HygR"
/note="aminoglycoside phosphotransferase from E. coli"
terminator 6701..6953
/label="NOS terminator"
/note="nopaline synthase terminator and poly(A) signal"
primer_bind complement(7528..7545)
/label="M13 Forward"
/note="In lacZ gene. Also called M13-F20 or M13 (-21)
Forward"
primer_bind complement(7528..7544)
/label="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
primer_bind complement(7537..7559)
/label="M13/pUC Forward"
/note="In lacZ gene"
misc_feature complement(7766..7790)
/label="LB T-DNA repeat"
/note="left border repeat from nopaline C58 T-DNA"
CDS 8311..9099
/label="SmR"
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
rep_origin 9348..9936
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
primer_bind 10090..10107
/label="L4440"
/note="L4440 vector, forward primer"
misc_feature complement(10122..10262)
/label="bom"
/note="basis of mobility region from pBR322"
primer_bind 10348..10370
/label="pGEX 3'"
/note="pGEX vectors, reverse primer"
rep_origin complement(10606..10800)
/direction=LEFT
/label="pVS1 oriV"
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
CDS complement(10869..11939)
/label="pVS1 RepA"
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
CDS complement(12371..12997)
/label="pVS1 StaA"
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"