Cre-IRES-PuroR vector (V001194#)

Basic Vector Information

Basic Vector Information
Vector Name Cre-IRES-PuroR Antibiotic Resistance Ampicillin
Length 9229 bp Type Mammalian Expression, Lentiviral
Selection Marker Puromycin Copy Number High Copy
Promoter EF1a Cloning Method Restriction Enzyme
5' Primer GGTTCATTCTCAAGCCTCAGACAGTG

Cre-IRES-PuroR vector Vector Map

Cre-IRES-PuroR9229 bp400800120016002000240028003200360040004400480052005600600064006800720076008000840088009200EBV-rev3' LTRHIV-1 PsiRREgp41 peptidecPPT/CTSEF-1-alpha promoterKozak sequenceCreIRESPuroRWPRE5' LTR (truncated)pBRforEcoAmpR promoterAmpRoriL4440SV40pro-FCAP binding sitelac promoterlac operatorM13 rev

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

Cre-IRES-PuroR vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                9229 bp ds-DNA     circular SYN 13-MAY-2021
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Cre-IRES-PuroR
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9229)
  AUTHORS   Somers A, Jean JC, Sommer CA, Omari A, Ford CC, Mills JA, Ying L, 
            Sommer AG, Jean JM, Smith BW, Lafyatis R, Demierre MF, Weiss DJ, 
            French DL, Gadue P, Murphy GJ, Mostoslavsky G, Kotton DN
  TITLE     Generation of transgene-free lung disease-specific human induced 
            pluripotent stem cells using a single excisable lentiviral stem cell
            cassette.
  JOURNAL   Stem Cells. 2010 Oct . 28(10):1728-40.
  PUBMED    20715179
REFERENCE   2  (bases 1 to 9229)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Stem Cells.
            2010 Oct . 28(10):1728-40."
FEATURES             Location/Qualifiers
     source          1..9229
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     primer_bind     55..74
                     /label=EBV-rev
                     /note="SV40 polyA terminator, reverse primer"
     LTR             266..899
                     /label=3' LTR
                     /note="3' long terminal repeat (LTR) from HIV-1"
     misc_feature    946..1071
                     /label=HIV-1 Psi
                     /note="packaging signal of human immunodeficiency virus 
                     type 1"
     misc_feature    1568..1801
                     /label=RRE
                     /note="The Rev response element (RRE) of HIV-1 allows for 
                     Rev-dependent mRNA export from the nucleus to the 
                     cytoplasm."
     CDS             1986..2030
                     /codon_start=1
                     /product="antigenic peptide corresponding to amino acids 
                     655 to 669 of the HIV envelope protein gp41 (Lutje Hulsik 
                     et al., 2013)"
                     /label=gp41 peptide
                     /note="recognized by the 2H10 single-chain llama nanobody"
                     /translation="KNEQELLELDKWASL"
     misc_feature    2323..2440
                     /label=cPPT/CTS
                     /note="central polypurine tract and central termination 
                     sequence of HIV-1"
     promoter        2488..3666
                     /label=EF-1-alpha promoter
                     /note="strong constitutive promoter for human elongation 
                     factor EF-1-alpha"
     intron          2719..3657
                     /label=EF-1-alpha intron A
                     /note="intron upstream of the start codon of human 
                     EF-1-alpha"
     primer_bind     3614..3634
                     /label=EF1a-F
                     /note="Human elongation factor-1a promoter, forward primer"
     regulatory      3671..3680
                     /regulatory_class="other"
                     /label=Kozak sequence
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     CDS             3710..4738
                     /codon_start=1
                     /product="site-specific recombinase"
                     /label=Cre
                     /note="Cre is a site-specific recombinase from 
                     bacteriophage P1. Recombination occurs at loxP sequences."
                     /translation="SNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLL
                     SVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLP
                     RPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFL
                     GIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVER
                     WISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQR
                     YLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLED
                     GD"
     misc_feature    4742..5309
                     /label=IRES
                     /note="internal ribosome entry site (IRES) of the 
                     encephalomyocarditis virus (EMCV)"
     misc_feature    4759..5311
                     /label=IRES
                     /note="internal ribosome entry site (IRES) of the 
                     encephalomyocarditis virus (EMCV)"
     primer_bind     complement(4903..4920)
                     /label=IRES reverse
                     /note="IRES internal ribosome entry site, reverse primer. 
                     Also called pCDH-rev"
     primer_bind     5130..5149
                     /label=IRES-F
                     /note="IRES internal ribosome entry site, forward primer"
     CDS             5323..5922
                     /codon_start=1
                     /gene="pac from Streptomyces alboniger"
                     /product="puromycin N-acetyltransferase"
                     /label=PuroR
                     /note="confers resistance to puromycin"
                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"
     primer_bind     complement(5323..5342)
                     /label=Puro-R
                     /note="Puromycin resistance gene, reverse primer. Also 
                     called puro-variant-R"
     primer_bind     5819..5839
                     /label=Puro-F
                     /note="Puromycin resistance gene, forward primer"
     misc_feature    5936..6524
                     /label=WPRE
                     /note="woodchuck hepatitis virus posttranscriptional 
                     regulatory element"
     primer_bind     complement(5989..6009)
                     /label=WPRE-R
                     /note="WPRE, reverse primer"
     CDS             complement(6407..6418)
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /label=Factor Xa site
                     /translation="IEGR"
     LTR             6672..6852
                     /label=5' LTR (truncated)
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     primer_bind     complement(6899..6917)
                     /label=pBRforEco
                     /note="pBR322 vectors, upsteam of EcoRI site, forward 
                     primer"
     promoter        6985..7089
                     /gene="bla"
                     /label=AmpR promoter
     CDS             7090..7950
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     primer_bind     complement(7308..7327)
                     /label=Amp-R
                     /note="Ampicillin resistance gene, reverse primer"
     rep_origin      8121..8709
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     primer_bind     8610..8629
                     /label=pBR322ori-F
                     /note="pBR322 origin, forward primer"
     primer_bind     8863..8880
                     /label=L4440
                     /note="L4440 vector, forward primer"
     primer_bind     8972..8991
                     /label=SV40pro-F
                     /note="SV40 promoter/origin, forward primer"
     protein_bind    9120..9141
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     promoter        9156..9186
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    9194..9210
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     9199..9221
                     /label=M13/pUC Reverse
                     /note="In lacZ gene"
     primer_bind     join(9218..9229,1..5)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     join(9218..9229,1..5)
                     /label=M13 Reverse
                     /note="In lacZ gene. Also called M13-rev"

This page is informational only.