Basic Vector Information
- Vector Name:
- G-CaMP3
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5311 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- EGFP-N
G-CaMP3 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
G-CaMP3 vector Sequence
LOCUS 40924_934 5311 bp DNA circular SYN 13-MAY-2021 DEFINITION a single-wavelength GCaMP2-based genetically encoded calcium indicator. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5311) AUTHORS Tian L, Hires SA, Mao T, Huber D, Chiappe ME, Chalasani SH, Petreanu L, Akerboom J, McKinney SA, Schreiter ER, Bargmann CI, Jayaraman V, Svoboda K, Looger LL. TITLE Imaging neural activity in worms, flies and mice with improved GCaMP calcium indicators. JOURNAL Nat Methods. 2009 Dec;6(12):875-81. PUBMED 19898485 REFERENCE 2 (bases 1 to 5311) TITLE Direct Submission REFERENCE 3 (bases 1 to 5311) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Methods."; date: "2009-12"; volume: "6(12)"; pages: "875-81" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..5311 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 1..204 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 261..1610 /codon_start=1 /label=GCaMP6f /note="improved fluorescent protein-based calcium sensor (Chen et al., 2013)" /translation="MGSHHHHHHGMASMTGGQQMGRDLYDDDDKDLATMVDSSRRKWNK TGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGP VLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGTGGSMVSKGEE LFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLT YGVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIE LKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRS LGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGN GYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK" polyA_signal 1735..1856 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1863..2318) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2345..2449 /label=AmpR promoter promoter 2451..2808 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2843..3634 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" primer_bind complement(3825..3844) /label=TK-pA-R /note="Thymidine kinase polyA, reverse primer" polyA_signal 3869..3916 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4245..4833 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" enhancer 5008..5311 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer"
This page is informational only.