MTS-mCherry-GFP1-10-Hyg-N1 vector (Cat. No.: V001370)
Note: This mammalian split-GFP reporter plasmid is modified from the pDsRedMonomer-Hyg-N1 backbone. It encodes a fusion protein consisting of a mitochondrial targeting sequence (MTS), mCherry, and the non-fluorescent GFP₁₋₁₀ fragment, alongside a hygromycin resistance cassette for stable cell selection. MTS directs GFP₁₋₁₀ exclusively into the mitochondrial matrix. When co-transfected with plasmids carrying aggregation-prone proteins tagged with GFP₁₁, GFP₁₋₁₀ reassembles with GFP₁₁ to generate green fluorescence only if the target protein is imported into mitochondria. The mCherry signal serves as an internal mitochondrial marker to normalize and quantify split-GFP intensity, enabling visual and quantitative detection of cytosolic misfolded protein translocation into mitochondria to verify the conserved MAGIC proteostasis pathway in human RPE1 cells.
- Name:
- MTS-mCherry-GFP1-10-Hyg-N1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6655 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- CMV
- Cloning Method:
- Restriction Enzyme
- Growth Strain(s):
- DH10B
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Cytosolic proteostasis through importing of misfolded proteins into mitochondria. Ruan L, Zhou C, Jin E, Kucharavy A, Zhang Y, Wen Z, Florens L, Li R. Nature. 2017 Mar 16;543(7645):443-446. doi: 10.1038/nature21695. Epub 2017 Mar 1. 10.1038/nature21695 PubMed 28241148
MTS-mCherry-GFP1-10-Hyg-N1 vector (Cat. No.: V001370) Sequence
LOCUS Exported 6655 bp DNA circular SYN 20-DEC-2024
DEFINITION Expresses mCherry-GFP1-10 in mammalian cell mitochondria.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6655)
AUTHORS Ruan L, Zhou C, Jin E, Kucharavy A, Zhang Y, Wen Z, Florens L, Li R
TITLE Cytosolic proteostasis through importing of misfolded proteins into
mitochondria.
JOURNAL Nature. 2017 Mar 16;543(7645):443-446. doi: 10.1038/nature21695.
Epub 2017 Mar 1.
PUBMED 28241148
REFERENCE 2 (bases 1 to 6655)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 6655)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6655)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; doi:
"10.1038/nature21695"; journalName: "Nature"; date: "2017-03-16-
16"; volume: "543"; issue: "7645"; pages: "443-446"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6655
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 4..67
/label=AmpR promoter
promoter 69..426
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
CDS 434..1456
/codon_start=1
/label=HygR
/note="aminoglycoside phosphotransferase from E. coli"
/translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG
YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP
ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ
TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF
GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG
NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK
E"
polyA_signal 1576..1657
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
primer_bind complement(1685..1703)
/label=pBRforEco
/note="pBR322 vectors, upsteam of EcoRI site, forward
primer"
promoter 1771..1875
/label=AmpR promoter
CDS 1876..2733
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
rep_origin 2922..3510
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
enhancer 3685..3988
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 3989..4192
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
CDS 4269..4475
/codon_start=1
/product="mitochondria-targeting sequence"
/label=MTS
/translation="MASTRVLASRLASRMAASAKVARPAVRVAQVSKRTIQTGSPLQTL
KRTQMTSIVNATTRQAFQKRAYSS"
CDS 4503..5210
/codon_start=1
/label=mCherry
/note="monomeric derivative of DsRed fluorescent protein
(Shaner et al., 2004)"
/translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG
TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF
EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK
GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA
EGRHSTGGMDELYK"
CDS 5241..5882
/codon_start=1
/label=GFP(1-10)
/note="fragment of superfolder GFP consisting of the first
10 beta-strands"
/translation="MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATIGKLTLK
FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDG
KYKTRAVVKFEGDTLVNRIELKGTDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKA
NFTVRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQTVLSKDPNEK"
polyA_signal 6008..6129
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin complement(6136..6591)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"