Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V001454 | pBAD18 | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
Vector backbone:pKK223-3 Article: Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. Guzman LM et al. (J Bacteriol. 1995 Jul . 177(14):4121-30. Pubmed)
- Vector Name:
- pBAD18
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4613 bp
- Type:
- E.coli vector; pBAD series expression plasmid
- Replication origin:
- ori
- Source/Author:
- Guzman LM et al.
- Promoter:
- araBAD
pBAD18 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pBAD18 vector Sequence
LOCUS 40924_5789 4613 bp DNA circular SYN 16-OCT-2020 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4613) TITLE Direct Submission REFERENCE 2 (bases 1 to 4613) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..4613 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 1..285 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" misc_feature 306..362 /label=MCS /note="pUC18/19 multiple cloning site" terminator 565..651 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 743..770 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 789..880 /label=AmpR promoter CDS 881..1738 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 1783..2238 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" rep_origin 2349..2937 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(3123..3263) /label=bom /note="basis of mobility region from pBR322" CDS complement(3712..4587) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS"