Basic Vector Information
- Vector Name:
- yy447
- Antibiotic Resistance:
- Streptomycin
- Length:
- 10459 bp
- Type:
- LUC binary vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Yoshioka Y.
- Promoter:
- NOS
yy447 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
yy447 vector Sequence
LOCUS 40924_49797 10459 bp DNA circular SYN 18-DEC-2018 DEFINITION LUC binary vector yy447 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10459) AUTHORS Yoshioka Y. TITLE Plasmid Vector for Nondestructive in vivo Functional Analysis of Gene Expression by LUC Reporter System and simplified Estimation Method of Copy Numbers of T-DNA in Transgenic Arabidopsis Plants by Competitive PCR JOURNAL Unpublished REFERENCE 2 (bases 1 to 10459) AUTHORS Yamamoto YY, Yoshioka Y. TITLE Direct Submission JOURNAL Submitted (08-JUN-2011) Contact:Yoshiharu Y Yamamoto Gifu university, Faculty of applied biological science; 1-1 Yanagido, Gifu, Gifu 501-1193, Japan URL :http://www1.gifu-u.ac.jp/~yyy REFERENCE 3 (bases 1 to 10459) TITLE Direct Submission REFERENCE 4 (bases 1 to 10459) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-JUN-2011) Contact:Yoshiharu Y Yamamoto Gifu university, Faculty of applied biological science"; volume: " 1-1 Yanagido, Gifu, Gifu 501-1193, Japan URL :http"; pages: "//www1.gifu-u.ac.jp/~yy" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10459 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1187..1813 /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI" CDS 2250..3314 /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV MRYRNLIEGEASAGS" rep_origin 3383..3577 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 3921..4061 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(4247..4835) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5082..5870) /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" misc_feature 6398..6422 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" promoter 6576..6755 /label=NOS promoter /note="nopaline synthase promoter" misc_feature 6793..6848 /label=TMV Omega /note="translational enhancer from the tobacco mosaic virus 5'-leader sequence (Gallie et al., 1988)" CDS 6850..7398 /codon_start=1 /label=BlpR /note="phosphinothricin acetyltransferase" /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF WQLDFSLPVPPRPVLPVTEI" terminator 7428..8135 /label=OCS terminator /note="octopine synthase terminator" misc_feature 8148..8217 /label=CIP7 intron with 12 bp-deletion /note="CIP7 intron with 12 bp-deletion" promoter 8247..8293 /label=minimal CaMV 35S promoter /note="minimal 35S promoter from cauliflower mosaic virus" CDS 8323..9969 /codon_start=1 /label=luciferase /note="firefly luciferase" /translation="EDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAH IEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPA NDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSM YTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHAR DPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKI QSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYG LTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSG YVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILL QHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVF VDEVPKGLTGKLDARKIREILIKAKKGGKIAV" terminator 10000..10253 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" misc_feature 10322..10346 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" terminator 10459 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal"
This page is informational only.