YFV-C3opt-NS2mut vector (V001484)

Basic Vector Information

      • Vector Name:
      • YFV-C3opt-NS2mut
      • Length:
      • 12840 bp
      • Type:
      • VEEV replicon vector
      • Source/Author:
      • Shustov AV, Frolov IV.

YFV-C3opt-NS2mut vector Vector Map

YFV-C3opt-NS2mut12840 bp60012001800240030003600420048005400600066007200780084009000960010200108001140012000126005'UTR of Venezuelan equine encephalitis virus VEE TC83nsP1 of Venezuelan equine encephalitis virus VEE TC83nsP2 of Venezuelan equine encephalitis virus VEE TC83nsP3 of Venezuelan equine encephalitis virus VEE TC83nsP4 of Venezuelan equine encephalitis virus VEE TC83Yellow fever virus 17D capsid protein (synthetic, codon-optimized)PR of Yellow fever virus 17DM of Yellow fever virus 17DE of Yellow fever virus 17Dsubgenomic promoter of Venezuelan equine encephalitis virus VEE TC83 (second copy)Pac3'UTR of Venezuelan equine encephalitis virus VEE TC83AmpR promoterBlaori

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

YFV-C3opt-NS2mut vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported               12840 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  VEEV replicon vector YFV-C3opt-NS2mut, complete sequence.
ACCESSION   DQ322640
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12840)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Trans-packaging of Yellow Fever virus replicons: an approach for 
            flaviviral antigen production
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 12840)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2005) Department of Microbiology and Immunology, 
            University of Texas Medical Branch, 301 University Boulevard, 
            Galveston, TX 77550-1019, USA
REFERENCE   3  (bases 1 to 12840)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..12840
                     /organism="VEEV replicon vector YFV-C3opt-NS2mut"
                     /focus
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
                     /db_xref="taxon:364090"
     source          7934..9904
                     /organism="Yellow fever virus 17D"
                     /mol_type="other DNA"
                     /db_xref="taxon:11090"
     misc_feature    2..45
                     /note="5'UTR of Venezuelan equine encephalitis virus VEE 
                     TC83"
     misc_feature    46..1650
                     /note="nsP1 of Venezuelan equine encephalitis virus VEE 
                     TC83"
     RBS             1536..1544
                     /label=Shine-Dalgarno sequence
                     /note="full consensus sequence for ribosome-binding sites 
                     upstream of start codons in E. coli; complementary to a 
                     region in the 3' end of the 16S rRNA (Chen et al., 1994)"
     misc_feature    1651..4032
                     /note="nsP2 of Venezuelan equine encephalitis virus VEE 
                     TC83"
     misc_feature    3866
                     /note="A->T mutation from TC83 sequence produce Leu mutant 
                     in nsP2"
     misc_feature    4033..5703
                     /note="nsP3 of Venezuelan equine encephalitis virus VEE 
                     TC83"
     misc_feature    5704..7524
                     /note="nsP4 of Venezuelan equine encephalitis virus VEE 
                     TC83"
     misc_feature    7502..7546
                     /note="subgenomic promoter of Venezuelan equine 
                     encephalitis virus VEE TC83"
     misc_feature    7571..7933
                     /note="Yellow fever virus 17D capsid protein (synthetic, 
                     codon-optimized)"
     misc_feature    7934..8200
                     /label=PR of Yellow fever virus 17D
                     /note="PR of Yellow fever virus 17D"
     misc_feature    8201..8425
                     /label=M of Yellow fever virus 17D
                     /note="M of Yellow fever virus 17D"
     misc_feature    8426..9904
                     /label=E of Yellow fever virus 17D
                     /note="E of Yellow fever virus 17D"
     misc_feature    9910..9953
                     /note="subgenomic promoter of Venezuelan equine 
                     encephalitis virus VEE TC83 (second copy)"
     CDS             9983..10582
                     /codon_start=1
                     /product="puromycin-N-acetyl-transferase"
                     /label=puromycin-N-acetyl-transferase
                     /note="Pac"
                     /protein_id="ABC61539.1"
                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
                     APRNLPFYERLGFTVTADVECPKDRATWCMTRKPGA"
     misc_feature    10659..11014
                     /note="3'UTR of Venezuelan equine encephalitis virus VEE 
                     TC83"
     promoter        11078..11182
                     /gene="bla"
                     /label=AmpR promoter
     CDS             11183..12043
                     /codon_start=1
                     /product="Bla"
                     /function="ampicillin resistance"
                     /label=Bla
                     /protein_id="ABC61538.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      12214..12802
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     promoter        12824..2
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"

This page is informational only.