Cart 2

YEp24PGK vector (V001491#)

Basic Vector Information

Basic Vector Information
Vector Name YEp24PGK Antibiotic Resistance Ampicillin
Length 9637 bp Type Cloning vector
Source Johansson B.

YEp24PGK vector Vector Map

2u ori URA3 promoter URA3 from Saccharomyces cerevisiae PGK1 from Saccharomyces cerevisiae PGK1 tet rop bom ori bla AmpR promoter

YEp24PGK vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                9637 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector YEp24PGK, complete sequence.
ACCESSION   KC562906
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9637)
  AUTHORS   Johansson B.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2013) Department of Biology, University of Minho, 
            Campus de Gualtar, Braga 4710-051, Portugal
REFERENCE   2  (bases 1 to 9637)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..9637
                     /organism="Cloning vector YEp24PGK"
                     /mol_type="other DNA"
                     /db_xref="taxon:1289963"
     rep_origin      348..1690
                     /label=2u ori
                     /note="yeast 2u plasmid origin of replication"
     rep_origin      530..1690
                     /label=2 micron origin
                     /note="2 micron origin"
     protein_bind    680..727
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces 
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     promoter        2291..2506
                     /gene="S. cerevisiae URA3"
                     /label=URA3 promoter
     CDS             2507..3310
                     /codon_start=1
                     /gene="URA3"
                     /product="URA3"
                     /label=URA3
                     /protein_id="AGE61868.1"
                     /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL
                     ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ
                     YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE
                     YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD
                     VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
     gene            2507..3310
                     /gene="URA3"
                     /label=URA3
     regulatory      3452..4934
                     /regulatory_class="promoter"
                     /note="from Saccharomyces cerevisiae PGK1"
     regulatory      4941..5305
                     /regulatory_class="terminator"
                     /note="from Saccharomyces cerevisiae PGK1"
     terminator      5030..5300
                     /gene="S. cerevisae PGK1"
                     /label=PGK1 terminator
                     /note="transcription terminator for 3-phosphoglycerate 
                     kinase gene"
     CDS             5363..6553
                     /codon_start=1
                     /gene="tet"
                     /product="tetracyclin resistance protein"
                     /label=tet
                     /note="pBR322 marker"
                     /protein_id="AGE61866.1"
                     /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY
                     GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI
                     VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF
                     LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM
                     QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII
                     AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL
                     AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"
     gene            5363..6553
                     /gene="tet"
                     /label=tet
     CDS             7194..7385
                     /codon_start=1
                     /gene="rop"
                     /product="Rop protein, which maintains plasmids at low copy
                     number"
                     /label=rop
                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
                     DELYRSCLARFGDDGENL"
     misc_feature    7487..7627
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(7813..8401)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(8572..9432)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=bla
                     /note="ampicillin resistance protein"
                     /protein_id="AGE61867.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     gene            complement(8572..9432)
                     /gene="bla"
                     /label=bla
     promoter        complement(9433..9537)
                     /gene="bla"
                     /label=AmpR promoter

This page is informational only.