Basic Vector Information
- Vector Name:
- YCplac22 YCp-TG-She2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8721 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Belmont BJ, Niles JC.
- Promoter:
- TRP1
YCplac22 YCp-TG-She2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
YCplac22 YCp-TG-She2 vector Sequence
LOCUS 40924_49477 8721 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector YCplac22 YCp-TG-She2, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8721)
AUTHORS Belmont BJ, Niles JC.
TITLE Inducible Control of Subcellular RNA Localization Using a Synthetic
Protein-RNA Aptamer Interaction
JOURNAL PLoS ONE 7 (10), E46868 (2012)
PUBMED 23056498
REFERENCE 2 (bases 1 to 8721)
AUTHORS Belmont BJ, Niles JC.
TITLE Direct Submission
JOURNAL Submitted (12-SEP-2012) Biological Engineering, Massachusetts
Institute of Technology, 77 Massachusetts Ave, Cambridge, MA 02139,
USA
REFERENCE 3 (bases 1 to 8721)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 8721)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
date: "2012"; volume: "7"; issue: "10"; pages: "E46868"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(12-SEP-2012) Biological Engineering, Massachusetts Institute of
Technology, 77 Massachusetts Ave, Cambridge, MA 02139, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..8721
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 106..127
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 142..172
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 180..196
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 204..220
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
CDS 1021..1638
/codon_start=1
/gene="tetR from transposon Tn10"
/product="tetracycline repressor TetR"
/label=TetR
/note="TetR binds to the tetracycline operator tetO to
inhibit transcription. This inhibition can be relieved by
adding tetracycline or doxycycline."
/translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV
KNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTR
PTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPTT
DSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESG"
CDS complement(1643..1669)
/label=9xHis
/note="9xHis affinity tag"
CDS 1669..2382
/label=EGFP
/note="enhanced GFP"
CDS 2410..3147
/gene="SHE2"
/label=SHE2
/note="SWI5-dependent HO expression protein 2 from
Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
Accession#: P36068"
CDS complement(3718..3735)
/label=tetracysteine tag
/note="tetracysteine peptide that binds biarsenical
labeling reagents"
primer_bind complement(4157..4173)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature complement(4932..6094)
/label=CEN/ARS
/note="S. cerevisiae CEN4 centromere fused to the
autonomously replicating sequence ARS1/ARS416"
promoter complement(6608..6709)
/label=TRP1 promoter
promoter 6815..6919
/label=AmpR promoter
CDS 6920..7777
/label=AmpR
/note="beta-lactamase"
rep_origin 7951..8539
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.