VEE(wt).Pac-2A-GFP vector (V001513)

MSDS

Basic Vector Information

Vector Name:: VEE(wt).Pac-2A-GFP

Antibiotic Resistance:: Ampicillin

Length:: 14800 bp

Type:: Cloning vector

Replication origin:: ori

Source/Author:: Kim YG, Baltabekova AZ, Shustov AV.

VEE(wt).Pac-2A-GFP vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

VEE(wt).Pac-2A-GFP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_49352       14800 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector VEE(wt).Pac-2A-GFP, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 14800)
  AUTHORS   Kim YG, Baltabekova AZ, Shustov AV.
  TITLE     Poxvirus' interferon inhibitor B18R: recombinant expression, 
            refolding and use in mammalian expression system based on viral 
            vectors
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 14800)
  AUTHORS   Kim YG, Baltabekova AZ, Shustov AV.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAY-2017) National Center for Biotechnology, 
            Korgalzhin hwy 13/5, Astana, Akmola region 010000, Kazakhstan
REFERENCE   3  (bases 1 to 14800)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 14800)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (18-MAY-2017) National Center for Biotechnology, Korgalzhin hwy 
            13/5, Astana, Akmola region 010000, Kazakhstan"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..14800
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     RBS             1536..1544
                     /label=Shine-Dalgarno sequence
                     /note="full consensus sequence for ribosome-binding sites 
                     upstream of start codons in E. coli; complementary to a 
                     region in the 3' end of the 16S rRNA (Chen et al., 1994)"
     CDS             7576..8172
                     /codon_start=1
                     /gene="pac from Streptomyces"
                     /product="puromycin N-acetyltransferase"
                     /label=PuroR
                     /note="confers resistance to puromycin"
                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
                     APRNLPFYERLGFTVTADVECPKDRATWCMTRKPGA"
     CDS             8224..8940
                     /label=EGFP
                     /note="enhanced GFP"
     CDS             9063..12827
                     /note="Structural polyprotein from Venezuelan equine 
                     encephalitis virus (strain P676). Accession#: P36332"
     promoter        13038..13142
                     /label=AmpR promoter
     CDS             13143..14000
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      14174..14762
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.