Basic Vector Information
- Vector Name:
- VEE(L.Cm).Pac-2A-GFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 14800 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Kim YG, Baltabekova AZ, Shustov AV.
VEE(L.Cm).Pac-2A-GFP vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
VEE(L.Cm).Pac-2A-GFP vector Sequence
LOCUS 40924_49342 14800 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector VEE(L.Cm).Pac-2A-GFP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 14800) AUTHORS Kim YG, Baltabekova AZ, Shustov AV. TITLE Poxvirus' interferon inhibitor B18R: recombinant expression, refolding and use in mammalian expression system based on viral vectors JOURNAL Unpublished REFERENCE 2 (bases 1 to 14800) AUTHORS Kim YG, Baltabekova AZ, Shustov AV. TITLE Direct Submission JOURNAL Submitted (18-MAY-2017) National Center for Biotechnology, Korgalzhin hwy 13/5, Astana, Akmola region 010000, Kazakhstan REFERENCE 3 (bases 1 to 14800) TITLE Direct Submission REFERENCE 4 (bases 1 to 14800) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-MAY-2017) National Center for Biotechnology, Korgalzhin hwy 13/5, Astana, Akmola region 010000, Kazakhstan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..14800 /mol_type="other DNA" /organism="synthetic DNA construct" RBS 1536..1544 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" CDS 7576..8172 /codon_start=1 /gene="pac from Streptomyces" /product="puromycin N-acetyltransferase" /label=PuroR /note="confers resistance to puromycin" /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS APRNLPFYERLGFTVTADVECPKDRATWCMTRKPGA" CDS 8224..8940 /label=EGFP /note="enhanced GFP" CDS 9063..12827 /note="Structural polyprotein from Venezuelan equine encephalitis virus (strain 3880). Accession#: P36329" promoter 13038..13142 /label=AmpR promoter CDS 13143..14000 /label=AmpR /note="beta-lactamase" rep_origin 14174..14762 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.