Basic Vector Information
- Vector Name:
- pCVD056
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4866 bp
- Type:
- Broad host range vector
- Replication origin:
- ori
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD056 vector Map
pCVD056 vector Sequence
LOCUS 40924_49262 4866 bp DNA circular SYN 18-DEC-2018
DEFINITION Broad host range vector vector pCVD056, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4866)
AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B,
Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
TITLE Broad-host-range vector system for synthetic biology and
biotechnology in cyanobacteria
JOURNAL Nucleic Acids Res. (2014) In press
PUBMED 25074377
REFERENCE 2 (bases 1 to 4866)
AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B,
Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW.
TITLE Direct Submission
JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University
of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA
REFERENCE 3 (bases 1 to 4866)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4866)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res. (2014) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(17-JUN-2014) Division of Biological Sciences, University of
California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4866
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 379..395
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 405..410
/label=ZraI
/note="ZraI"
misc_feature 408..2581
/note="CVD-CYA; device for the GC-adaptor assembly:
cyanobacterial replicons"
misc_feature 408..428
/note="G5C5; GC-adaptor for seamless assembly, flanking a
BHR replicons, neutral sites, or cyanobacterial replicons;
synthetic"
misc_feature 429..434
/label=XbaI
/note="XbaI"
CDS complement(585..1892)
/codon_start=1
/product="repA-pFDA"
/label=repA-pFDA
/note="repA-pFDA; derived from pPL2; 7; Fremyella
diplosiphon PCC7601"
/protein_id="AII99654.1"
/translation="MKHTTFPHSNIIAQSTATEGENFVLQTRLHASILLLTPASKLWYL
CRALDLSGRGYVVLSPQNLELLQEKKSTIYRWLKDGKDLGLFRCYSWAGNTLKISLGSL
WRACKKARIKNWGTVANNIPLEEILKNNGRRTVATAMTIQDWQERSRYAAKNQLNPLER
KCFEIPATADVLTPQTSPKLTSGGTTGVLHVGEKRIFVGRSFIPFGVSQKRISNELNSQ
PASCGVSVRTVQRHVERLEVKHRQLMQARREYREIAHRIKQGATSWQCKSDADISFTWG
NQPDEIVLHERNGKSSARREGGHTIKLDQLCNYSNTHWRYRCNLYLLSYELTSMRTTRY
QWKKRGLNVKIAPVENCPSEISPQTPEMLESPKLHAEGRGLGGQNKSVKNENPQEVDTV
SNAFAPGGSEWAKTKAMLLAKQAERRQKRWDSLNSI"
misc_feature 1152..1157
/label=MfeI
/note="MfeI"
regulatory complement(1893..2554)
/note="PrepA; 662 nts upstream of repA-pFDA; derived from
pPL2.7; Fremyella diplosiphon PCC7601"
/regulatory_class="promoter"
misc_feature 2417..2422
/label=EcoRV
/note="EcoRV"
misc_feature 2555..2560
/label=MfeI
/note="MfeI"
misc_feature 2561..2581
/note="C3G3; GC-adaptor for seamless assembly, flanking
cyanobacterial replicons; synthetic"
misc_feature 2579..2584
/label=ZraI
/note="ZraI"
misc_feature 2603..2608
/label=XbaI
/note="XbaI"
primer_bind complement(2645..2661)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(2669..2685)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(2693..2723)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(2738..2759)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(3047..3635)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3809..4666)
/label=AmpR
/note="beta-lactamase"
promoter complement(4667..4771)
/label=AmpR promoter
misc_feature 4797..4802
/label=ZraI
/note="ZraI"
This page is informational only.