Basic Vector Information
- Vector Name:
- pCVD056
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4866 bp
- Type:
- Broad host range vector
- Replication origin:
- ori
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD056 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pCVD056 vector Sequence
LOCUS 40924_49262 4866 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad host range vector vector pCVD056, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4866) AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW. TITLE Broad-host-range vector system for synthetic biology and biotechnology in cyanobacteria JOURNAL Nucleic Acids Res. (2014) In press PUBMED 25074377 REFERENCE 2 (bases 1 to 4866) AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B, Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA REFERENCE 3 (bases 1 to 4866) TITLE Direct Submission REFERENCE 4 (bases 1 to 4866) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4866 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 405..410 /label=ZraI /note="ZraI" misc_feature 408..2581 /note="CVD-CYA; device for the GC-adaptor assembly: cyanobacterial replicons" misc_feature 408..428 /note="G5C5; GC-adaptor for seamless assembly, flanking a BHR replicons, neutral sites, or cyanobacterial replicons; synthetic" misc_feature 429..434 /label=XbaI /note="XbaI" CDS complement(585..1892) /codon_start=1 /product="repA-pFDA" /label=repA-pFDA /note="repA-pFDA; derived from pPL2; 7; Fremyella diplosiphon PCC7601" /protein_id="AII99654.1" /translation="MKHTTFPHSNIIAQSTATEGENFVLQTRLHASILLLTPASKLWYL CRALDLSGRGYVVLSPQNLELLQEKKSTIYRWLKDGKDLGLFRCYSWAGNTLKISLGSL WRACKKARIKNWGTVANNIPLEEILKNNGRRTVATAMTIQDWQERSRYAAKNQLNPLER KCFEIPATADVLTPQTSPKLTSGGTTGVLHVGEKRIFVGRSFIPFGVSQKRISNELNSQ PASCGVSVRTVQRHVERLEVKHRQLMQARREYREIAHRIKQGATSWQCKSDADISFTWG NQPDEIVLHERNGKSSARREGGHTIKLDQLCNYSNTHWRYRCNLYLLSYELTSMRTTRY QWKKRGLNVKIAPVENCPSEISPQTPEMLESPKLHAEGRGLGGQNKSVKNENPQEVDTV SNAFAPGGSEWAKTKAMLLAKQAERRQKRWDSLNSI" misc_feature 1152..1157 /label=MfeI /note="MfeI" regulatory complement(1893..2554) /note="PrepA; 662 nts upstream of repA-pFDA; derived from pPL2.7; Fremyella diplosiphon PCC7601" /regulatory_class="promoter" misc_feature 2417..2422 /label=EcoRV /note="EcoRV" misc_feature 2555..2560 /label=MfeI /note="MfeI" misc_feature 2561..2581 /note="C3G3; GC-adaptor for seamless assembly, flanking cyanobacterial replicons; synthetic" misc_feature 2579..2584 /label=ZraI /note="ZraI" misc_feature 2603..2608 /label=XbaI /note="XbaI" primer_bind complement(2645..2661) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2669..2685) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2693..2723) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2738..2759) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3047..3635) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3809..4666) /label=AmpR /note="beta-lactamase" promoter complement(4667..4771) /label=AmpR promoter misc_feature 4797..4802 /label=ZraI /note="ZraI"
This page is informational only.