Basic Vector Information
- Vector Name:
- pCVD055
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5021 bp
- Type:
- Broad host range vector
- Replication origin:
- ori
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD055 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pCVD055 vector Sequence
LOCUS 40924_49257 5021 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad host range vector vector pCVD055, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5021) AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW. TITLE Broad-host-range vector system for synthetic biology and biotechnology in cyanobacteria JOURNAL Nucleic Acids Res. (2014) In press PUBMED 25074377 REFERENCE 2 (bases 1 to 5021) AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B, Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA REFERENCE 3 (bases 1 to 5021) TITLE Direct Submission REFERENCE 4 (bases 1 to 5021) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5021 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 405..410 /label=ZraI /note="ZraI" misc_feature 408..428 /note="G5C5; GC-adaptor for seamless assembly, flanking a BHR replicons, neutral sites, or cyanobacterial replicons; synthetic" misc_feature 429..434 /label=XbaI /note="XbaI" regulatory complement(471..498) /note="rho-ITTS; rho-ITTS; rho-independent transcriptional termination signal, downstream of repA in pDU1, from pAM505; Nostoc sp. PCC7524" /regulatory_class="terminator" CDS complement(577..1698) /codon_start=1 /product="repA" /label=repA /note="repA-pDU1; derived from pAM0505; Nostoc sp. PCC7524" /protein_id="AII99687.1" /translation="MISPESLNTNVSLTLLTRELQTEIILGTYTVRVHTRIGREPCARL WYLCRALDKDGSGHLTLPLPVVQTFLDCSDKSVYRWLQDGKKIGAFRRYKIKAGMITVY LGGMFQVCYNLNLKRWGDVAVVPLVQVLSDLRSLTTGIVTQSFQQKSRYAANRQLKPEY RKLFGAPHPNELVKDTRQSSLKSPEGEVPCVLHISSSRIFVSKSFIHYGTSQKAVSCEL GIHKRTVRRHQKQLGMNRRQLCQAKIEYNQLRHARNNDASEFWAFTGTKTDIGYQVMGD AVVFSDGIAPGAKKRQPNTYQIDATEFDGRLFKVGDKVFMNRCNIYREQFTLTTMSAAR RKYHFKLSQCHFSENRAGRVGNRFVIGCHSGEI" misc_feature 877..882 /label=EcoRV /note="EcoRV" regulatory complement(1699..2348) /note="PrepA; PrepA; upstream region of repA of pDU1 including promoter and ribosomal binding site,derived from pAM505; Nostoc sp. PCC7524" /regulatory_class="promoter" misc_feature 1944..1949 /label=MfeI /note="MfeI" misc_feature 2349..2354 /label=SacI /note="SacI" protein_bind 2368..2389 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2404..2434 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2442..2458 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 2479..2652 /label=lacZ-alpha /note="LacZ-alpha fragment of beta-galactosidase" misc_feature 2710..2715 /label=SacI /note="SacI" misc_feature 2716..2736 /note="C3G3; GC-adaptor for seamless assembly, flanking cyanobacterial replicons; synthetic" misc_feature 2734..2739 /label=ZraI /note="ZraI" misc_feature 2758..2763 /label=XbaI /note="XbaI" primer_bind complement(2800..2816) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2824..2840) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2848..2878) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2893..2914) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3202..3790) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3964..4821) /label=AmpR /note="beta-lactamase" promoter complement(4822..4926) /label=AmpR promoter misc_feature 4952..4957 /label=ZraI /note="ZraI"
This page is informational only.