Basic Vector Information
- Vector Name:
- pCVD052
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6852 bp
- Type:
- Broad host range vector
- Replication origin:
- ori
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD052 vector Map
pCVD052 vector Sequence
LOCUS 40924_49242 6852 bp DNA circular SYN 18-DEC-2018
DEFINITION Broad host range vector vector pCVD052, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6852)
AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B,
Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
TITLE Broad-host-range vector system for synthetic biology and
biotechnology in cyanobacteria
JOURNAL Nucleic Acids Res. (2014) In press
PUBMED 25074377
REFERENCE 2 (bases 1 to 6852)
AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B,
Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW.
TITLE Direct Submission
JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University
of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA
REFERENCE 3 (bases 1 to 6852)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6852)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res. (2014) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(17-JUN-2014) Division of Biological Sciences, University of
California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6852
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 379..395
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 405..410
/label=ZraI
/note="ZraI"
misc_feature complement(408..428)
/note="C3G3; GC-adaptor for seamless assembly, flanking
cyanobacterial replicons; synthetic"
misc_feature 429..434
/label=SacI
/note="SacI"
CDS complement(492..665)
/label=lacZ-alpha
/note="LacZ-alpha fragment of beta-galactosidase"
regulatory complement(667..789)
/note="PlacZa; lacI-lacZ intergenic region derived from
Escherichia coli including the promoter and RBS"
/regulatory_class="promoter"
regulatory complement(684..704)
/note="lacO; LacO; lac operator (lacO) from Invitrogen
pTrcHis2"
/regulatory_class="other"
protein_bind 686..702
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(710..740)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 755..776
/label=CAP binding site
/bound_moiety="E. coli catabolite activator protein"
/note="CAP binding activates transcription in the presence
of cAMP."
misc_feature 790..795
/label=SacI
/note="SacI"
regulatory 796..1445
/note="PrepA; PrepA; upstream region of repA of pDU1
including promoter and ribosomal binding site,derived from
pAM505; Nostoc sp. PCC7524"
/regulatory_class="promoter"
misc_feature 1195..1200
/label=MfeI
/note="MfeI"
CDS 1446..2567
/codon_start=1
/product="repA"
/label=repA
/note="repA-pDU1; derived from pAM0505; Nostoc sp. PCC7524"
/protein_id="AII99679.1"
/translation="MISPESLNTNVSLTLLTRELQTEIILGTYTVRVHTRIGREPCARL
WYLCRALDKDGSGHLTLPLPVVQTFLDCSDKSVYRWLQDGKKIGAFRRYKIKAGMITVY
LGGMFQVCYNLNLKRWGDVAVVPLVQVLSDLRSLTTGIVTQSFQQKSRYAANRQLKPEY
RKLFGAPHPNELVKDTRQSSLKSPEGEVPCVLHISSSRIFVSKSFIHYGTSQKAVSCEL
GIHKRTVRRHQKQLGMNRRQLCQAKIEYNQLRHARNNDASEFWAFTGTKTDIGYQVMGD
AVVFSDGIAPGAKKRQPNTYQIDATEFDGRLFKVGDKVFMNRCNIYREQFTLTTMSAAR
RKYHFKLSQCHFSENRAGRVGNRFVIGCHSGEI"
misc_feature 2262..2267
/label=EcoRV
/note="EcoRV"
regulatory 2646..2673
/note="rho-ITTS; rho-ITTS; rho-independent transcriptional
termination signal, downstream of repA in pDU1, from
pAM505; Nostoc sp. PCC7524"
/regulatory_class="terminator"
misc_feature 3084..3089
/label=XbaI
/note="XbaI"
CDS complement(3188..3739)
/codon_start=1
/product="orfC"
/label=orfC
/note="orfC-pDU1; derived from pAM0505;
integrase/recombinase plasmid stability; similar to INSD
accession AAM76170; Nostoc sp. PCC7524"
/protein_id="AII99678.1"
/translation="MKVNGNGRAKILTSDELRRLFSDGFTTPRDRVLFGICLFTGCRVS
EALALQTTDIKGETLTFRKSTTKGKLKTRVVDIQPGLAALMADYHPKPGTLFPGMRGVS
DRLTRYAADKILRDAAKRIGLEGISTHSFRRTALNQMSSAGIPLRHIQEISGHNDLGTL
QRYLEVTPEQRRKAVSVIGF"
misc_feature 3276..3281
/label=EcoRV
/note="EcoRV"
misc_feature 3617..3622
/label=AgeI
/note="AgeI"
misc_feature 4044..4049
/label=XbaI
/note="XbaI"
CDS complement(4111..4464)
/codon_start=1
/product="hyp1"
/label=hyp1
/note="hypothetical protein; derived from pAM505; Nostoc
sp. PCC7524"
/protein_id="AII99677.1"
/translation="MADKTLATFRIDSEEWESFKNLASSESSNASALLTEFVRWYLAGN
RFNTPTSHTPTHLDTSLEQRIDNIEQRLDKVTTNNLDNIDEFIDKRIEDNLATRLDKLQ
SQLEELRGKSKAR"
misc_feature 4163..4168
/label=XbaI
/note="XbaI"
misc_feature 4220..4225
/label=XbaI
/note="XbaI"
misc_feature 4244..4249
/label=XbaI
/note="XbaI"
misc_feature 4289..4294
/label=XbaI
/note="XbaI"
misc_feature 4533..4538
/label=XbaI
/note="XbaI"
misc_feature 4537..4542
/label=EcoRV
/note="EcoRV"
misc_feature 4541..4546
/label=XbaI
/note="XbaI"
misc_feature complement(4547..4567)
/note="G5C5; GC-adaptor for seamless assembly, flanking a
BHR replicons, neutral sites, or cyanobacterial replicons;
synthetic"
misc_feature 4565..4570
/label=ZraI
/note="ZraI"
misc_feature 4589..4594
/label=XbaI
/note="XbaI"
primer_bind complement(4631..4647)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4655..4671)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4679..4709)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4724..4745)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(5033..5621)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(5795..6652)
/label=AmpR
/note="beta-lactamase"
promoter complement(6653..6757)
/label=AmpR promoter
misc_feature 6783..6788
/label=ZraI
/note="ZraI"
This page is informational only.