Basic Vector Information
- Vector Name:
- pCVD051
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6491 bp
- Type:
- Broad host range vector
- Replication origin:
- ori
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD051 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pCVD051 vector Sequence
LOCUS 40924_49237 6491 bp DNA circular SYN 18-DEC-2018
DEFINITION Broad host range vector vector pCVD051, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6491)
AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B,
Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
TITLE Broad-host-range vector system for synthetic biology and
biotechnology in cyanobacteria
JOURNAL Nucleic Acids Res. (2014) In press
PUBMED 25074377
REFERENCE 2 (bases 1 to 6491)
AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B,
Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW.
TITLE Direct Submission
JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University
of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA
REFERENCE 3 (bases 1 to 6491)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6491)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res. (2014) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(17-JUN-2014) Division of Biological Sciences, University of
California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6491
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 379..395
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 405..410
/label=ZraI
/note="ZraI"
misc_feature complement(408..4206)
/note="CVD-CYA; device for the GC-adaptor assembly:
cyanobacterial replicons"
misc_feature complement(408..428)
/note="C3G3; GC-adaptor for seamless assembly, flanking
cyanobacterial replicons; synthetic"
misc_feature 429..434
/label=SacI
/note="SacI"
regulatory 435..1084
/note="PrepA; PrepA; upstream region of repA of pDU1
including promoter and ribosomal binding site,derived from
pAM505; Nostoc sp. PCC7524"
/regulatory_class="promoter"
misc_feature 834..839
/label=MfeI
/note="MfeI"
CDS 1085..2206
/codon_start=1
/product="repA"
/label=repA
/note="repA-pDU1; derived from pAM0505; Nostoc sp. PCC7524"
/protein_id="AII99675.1"
/translation="MISPESLNTNVSLTLLTRELQTEIILGTYTVRVHTRIGREPCARL
WYLCRALDKDGSGHLTLPLPVVQTFLDCSDKSVYRWLQDGKKIGAFRRYKIKAGMITVY
LGGMFQVCYNLNLKRWGDVAVVPLVQVLSDLRSLTTGIVTQSFQQKSRYAANRQLKPEY
RKLFGAPHPNELVKDTRQSSLKSPEGEVPCVLHISSSRIFVSKSFIHYGTSQKAVSCEL
GIHKRTVRRHQKQLGMNRRQLCQAKIEYNQLRHARNNDASEFWAFTGTKTDIGYQVMGD
AVVFSDGIAPGAKKRQPNTYQIDATEFDGRLFKVGDKVFMNRCNIYREQFTLTTMSAAR
RKYHFKLSQCHFSENRAGRVGNRFVIGCHSGEI"
misc_feature 1901..1906
/label=EcoRV
/note="EcoRV"
regulatory 2285..2312
/note="rho-ITTS; rho-ITTS; rho-independent transcriptional
termination signal, downstream of repA in pDU1, from
pAM505; Nostoc sp. PCC7524"
/regulatory_class="terminator"
misc_feature 2723..2728
/label=XbaI
/note="XbaI"
CDS complement(2827..3378)
/codon_start=1
/product="orfC"
/label=orfC
/note="orfC-pDU1; derived from pAM0505;
integrase/recombinase plasmid stability; similar to INSD
accession AAM76170; Nostoc sp. PCC7524"
/protein_id="AII99674.1"
/translation="MKVNGNGRAKILTSDELRRLFSDGFTTPRDRVLFGICLFTGCRVS
EALALQTTDIKGETLTFRKSTTKGKLKTRVVDIQPGLAALMADYHPKPGTLFPGMRGVS
DRLTRYAADKILRDAAKRIGLEGISTHSFRRTALNQMSSAGIPLRHIQEISGHNDLGTL
QRYLEVTPEQRRKAVSVIGF"
misc_feature 2915..2920
/label=EcoRV
/note="EcoRV"
misc_feature 3256..3261
/label=AgeI
/note="AgeI"
misc_feature 3683..3688
/label=XbaI
/note="XbaI"
CDS complement(3750..4103)
/codon_start=1
/product="hyp1"
/label=hyp1
/note="hypothetical protein; derived from pAM505; Nostoc
sp. PCC7524"
/protein_id="AII99673.1"
/translation="MADKTLATFRIDSEEWESFKNLASSESSNASALLTEFVRWYLAGN
RFNTPTSHTPTHLDTSLEQRIDNIEQRLDKVTTNNLDNIDEFIDKRIEDNLATRLDKLQ
SQLEELRGKSKAR"
misc_feature 3802..3807
/label=XbaI
/note="XbaI"
misc_feature 3859..3864
/label=XbaI
/note="XbaI"
misc_feature 3883..3888
/label=XbaI
/note="XbaI"
misc_feature 3928..3933
/label=XbaI
/note="XbaI"
misc_feature 4172..4177
/label=XbaI
/note="XbaI"
misc_feature 4176..4181
/label=EcoRV
/note="EcoRV"
misc_feature 4180..4185
/label=XbaI
/note="XbaI"
misc_feature complement(4186..4206)
/note="G5C5; GC-adaptor for seamless assembly, flanking a
BHR replicons, neutral sites, or cyanobacterial replicons;
synthetic"
misc_feature 4204..4209
/label=ZraI
/note="ZraI"
misc_feature 4228..4233
/label=XbaI
/note="XbaI"
primer_bind complement(4270..4286)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4294..4310)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4318..4348)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4363..4384)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(4672..5260)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(5434..6291)
/label=AmpR
/note="beta-lactamase"
promoter complement(6292..6396)
/label=AmpR promoter
misc_feature 6422..6427
/label=ZraI
/note="ZraI"
This page is informational only.