Basic Vector Information
pCVD049 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pCVD049 vector Sequence
LOCUS 40924_49227 4588 bp DNA circular SYN 18-DEC-2018
DEFINITION Broad host range vector vector pCVD049, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4588)
AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B,
Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
TITLE Broad-host-range vector system for synthetic biology and
biotechnology in cyanobacteria
JOURNAL Nucleic Acids Res. (2014) In press
PUBMED 25074377
REFERENCE 2 (bases 1 to 4588)
AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B,
Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW.
TITLE Direct Submission
JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University
of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA
REFERENCE 3 (bases 1 to 4588)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4588)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res. (2014) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(17-JUN-2014) Division of Biological Sciences, University of
California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4588
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 379..395
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 405..410
/label=EcoRV
/note="EcoRV"
misc_feature 408..2303
/note="CVD-CYA; device for the GC-adaptor assembly:
cyanobacterial replicons"
misc_feature 408..428
/note="G5C5; GC-adaptor for seamless assembly, flanking
functional devices, custom sequences or cyanobacterial
replicons; synthetic"
misc_feature 429..434
/label=XbaI
/note="XbaI"
CDS 585..1619
/codon_start=1
/product="repA"
/label=repA
/note="repA-pDC1; derived from pSUN202; Nostoc sp. PCC8009"
/protein_id="AII99715.1"
/translation="MANQNRAATQVEGLNHCPLTSQEDRSALSSNVPLPLVLILVKAEI
ILQPFMVRLHSGISRQPWARLWYLLRGFDDGSGRVKEIPLVLVEEILGVSQATVYRWLD
QGKAVGAFLSGYKVRIGLLTVYLGGLTKVAWHLNLKDWGVVAECPLWEVNANIRALTTG
IVTQRLQQRSRYAANRKLKPEYRKSYGAPHPNELLGDEGQSSFKLGAGEVPFVLHVSPS
RVFVSKSFIHYGTSQNAVSCKLGIHTRTVRRHQRTLGMEKRQLCQAKYEYAQLDRAVSN
EASECWAWSSEGTQSDIGYQSLGISHWVKGRSRFLMASCQEPESSSRTLTSCQRANCLG
VSSK"
misc_feature 991..998
/label=SwaI
/note="SwaI"
misc_feature 2277..2282
/label=MfeI
/note="MfeI"
misc_feature 2283..2303
/note="C3G3; GC-adaptor for seamless assembly, flanking
cyanobacterial replicons or Escherichia coli origins to be
assembled with a cyanobacterial replicon; synthetic"
misc_feature 2301..2306
/label=EcoRV
/note="EcoRV"
misc_feature 2325..2330
/label=XbaI
/note="XbaI"
primer_bind complement(2367..2383)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(2391..2407)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(2415..2445)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(2460..2481)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(2769..3357)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3531..4388)
/label=AmpR
/note="beta-lactamase"
promoter complement(4389..4493)
/label=AmpR promoter
misc_feature 4519..4524
/label=ZraI
/note="ZraI"
This page is informational only.