Basic Vector Information
- Vector Name:
- pCVD046
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7140 bp
- Type:
- Broad host range vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD046 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pCVD046 vector Sequence
LOCUS 40924_49212 7140 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad host range vector vector pCVD046, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7140) AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW. TITLE Broad-host-range vector system for synthetic biology and biotechnology in cyanobacteria JOURNAL Nucleic Acids Res. (2014) In press PUBMED 25074377 REFERENCE 2 (bases 1 to 7140) AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B, Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA REFERENCE 3 (bases 1 to 7140) TITLE Direct Submission REFERENCE 4 (bases 1 to 7140) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7140 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(124..981) /label=AmpR /note="beta-lactamase" promoter complement(982..1086) /label=AmpR promoter misc_feature 1112..1117 /label=ZraI /note="ZraI" misc_feature 1227..1232 /label=ZraI /note="ZraI" misc_feature 1230..1250 /note="G5C5; GC-adaptor for seamless assembly, flanking a BHR replicons, neutral sites, or cyanobacterial replicons; synthetic" misc_feature 1251..1256 /label=XbaI /note="XbaI" regulatory 1288..1314 /note="trpA T; trpA terminator from Lorist6 INSD accession X98450, one nt shorter than reference; Lorist6" /regulatory_class="terminator" CDS complement(1650..2498) /label=RSF1010 RepC /note="replication protein C of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS complement(2488..3324) /label=RSF1010 RepA /note="replication protein A of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS complement(3354..3560) /codon_start=1 /product="repF" /label=repF /note="repF-RSF1010; replication gene; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829" /protein_id="AII99697.1" /translation="MKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLTDDEY EALRECLEELRAAQGGGSDPASA" CDS complement(3562..3774) /codon_start=1 /product="repE" /label=repE /note="repE-RSF1010; replication gene; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829" /protein_id="AII99698.1" /translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMAS LNLDGCTLSLFREDKPFGPGKFLGD" regulatory complement(3804..3831) /note="P4; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829; the P4 promoter is under the auto-regulated control of the F repressor, whose gene is located in the same operon, providing transcription of E-F-repA-repC-operon" /regulatory_class="promoter" CDS complement(3838..4806) /label=RSF1010 RepB /note="replication protein B of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS complement(4803..5216) /codon_start=1 /product="mobB" /label=mobB /note="mobilization gene; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829" /protein_id="AII99695.1" /translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTKQAS EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR" misc_feature 5662..5667 /label=AgeI /note="AgeI" oriT complement(6045..6132) /direction=LEFT /label=RSF1010 oriT /note="origin of transfer of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" regulatory complement(6141..6172) /note="P1; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829; the P1 promoter is controlled by MobC and MobA provide transcription of mobA/repB, mobB, and, probably, E-F-repA-repC-operon" /regulatory_class="promoter" CDS 6163..6447 /codon_start=1 /product="mobC" /label=mobC /note="mobilization gene; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829" /protein_id="AII99694.1" /translation="MVKGSNKAADRLAKLEEQRARINAEIQRERAREQQQERKNETRRK VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG" rep_origin 6474..6868 /label=RSF1010 oriV /note="replication origin of the broad-host-range plasmid RSF1010; requires the RSF1010 RepA/B/C proteins for replication (Scholz et al., 1989)" terminator complement(7035..7078) /label=bacterial terminator /note="putative bacterial transcription terminator" regulatory complement(7044..7072) /note="TrrnC; rrnC terminator from Lorist6 INSD accession X98450; Lorist6" /regulatory_class="terminator" misc_feature 7111..7116 /label=NheI /note="NheI" misc_feature 7117..7137 /note="GC; GC-adaptor for seamless assembly, flanking BHR replicons or neutral sites; synthetic" misc_feature 7135..7140 /label=ZraI /note="ZraI"
This page is informational only.