Basic Vector Information
- Vector Name:
- pCVD012
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3400 bp
- Type:
- Broad host range vector
- Replication origin:
- ori
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD012 vector Map
pCVD012 vector Sequence
LOCUS 40924_49072 3400 bp DNA circular SYN 18-DEC-2018
DEFINITION Broad host range vector vector pCVD012, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3400)
AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B,
Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
TITLE Broad-host-range vector system for synthetic biology and
biotechnology in cyanobacteria
JOURNAL Nucleic Acids Res. (2014) In press
PUBMED 25074377
REFERENCE 2 (bases 1 to 3400)
AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B,
Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW.
TITLE Direct Submission
JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University
of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA
REFERENCE 3 (bases 1 to 3400)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3400)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res. (2014) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(17-JUN-2014) Division of Biological Sciences, University of
California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3400
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 293..309
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 320..338
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature 370..375
/label=EcoRV
/note="EcoRV"
misc_feature complement(373..1425)
/note="CVD-ANTR; device for the GC-adaptor assembly:
antibiotic resistance markers"
misc_feature complement(373..393)
/note="C2G; GC-adaptor for seamless assembly, flanking
antibiotic resistance markers, functional devices or custom
sequences; synthetic"
misc_feature 394..399
/label=AgeI
/note="AgeI"
regulatory 406..562
/note="PnptII; upstream region of nptII ORF including
promoter and RBS in INSD accession V00618; derived from
pAM505"
/regulatory_class="promoter"
CDS 563..1354
/codon_start=1
/product="nptII_A7120"
/label=nptII_A7120
/note="confers kanamycin resistance; aminoglycoside
phosphotransferase"
/protein_id="AII99780.1"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
regulatory 1363..1389
/note="trpA T; trpA terminator from Lorist6 INSD accession
X98450, one nt shorter than reference; Lorist6"
/regulatory_class="terminator"
misc_feature 1399..1404
/label=NheI
/note="NheI"
misc_feature complement(1405..1425)
/note="GC; GC-adaptor for seamless assembly, flanking
antibiotic resistance markers or Escherichia coli origins
to be assembled with a cyanobacterial replicon; synthetic"
misc_feature 1423..1428
/label=EcoRV
/note="EcoRV"
rep_origin complement(1653..2241)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(2415..3272)
/label=AmpR
/note="beta-lactamase"
promoter complement(3273..3377)
/label=AmpR promoter
This page is informational only.